Bioquímicos e reagentes

<p>The Cathepsin G antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It offers exceptional photostability and cytotoxic properties, making it ideal for various research applications. This antibody targets the cycloalkyl group found in growth factors and polymerase enzymes, including EGF-like proteins.</p>

<p>Rabbit polyclonal HNRPLL antibody</p>

<p>The CD105 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to CD105, also known as endoglin. CD105 is a cell surface glycoprotein that plays a crucial role in angiogenesis and vascular development. This antibody can be used in various immunoassays, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Rabbit polyclonal PGDH3 antibody (FITC)</p>

<p>Purified recombinant CST11 protein (His tag)</p>

<p>The DAP antibody is a highly specialized monoclonal antibody that acts as an inhibitory factor against chemokines. It binds to specific targets, such as annexin A2 and streptavidin, neutralizing their effects on cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>UBAC2 antibody was raised using the middle region of UBAC2 corresponding to a region with amino acids YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL</p>

<p>Purified Polyclonal Tumstatin antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNA12 antibody, catalog no. 70R-3131</p>

<p>The hnRNPF antibody is a highly specialized diagnostic reagent used in Life Sciences research. This monoclonal antibody specifically targets and binds to the hnRNPF protein complex, which plays a crucial role in regulating gene expression and RNA processing. The hnRNPF antibody can be used for various applications, including western blotting, immunohistochemistry, and ELISA assays.</p>

<p>Rabbit polyclonal C1QC antibody</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>MDK74978 is a small molecule that binds to the ATP-binding site of the HIF-1α kinase and inhibits its activity. It has been shown to inhibit the activity of other multi-kinase enzymes, such as PKCθ, Akt, and ERK1/2. MDK74978 has shown efficacy in animal models for treatment of iron overload disorders, such as hereditary hemochromatosis (HFE) and thalassemia major (HBA). In these models, MDK74978 improved iron homeostasis by increasing hepcidin synthesis in hepatocytes. This drug also showed efficacy in a mouse model with chronic kidney disease (CKD), which may be due to its ability to regulate erythropoietin production and enhance erythropoiesis.</p>

<p>Rabbit Polyclonal Chk2 antibody (Ser516)</p>

<p>Rabbit polyclonal Kinase E11 antibody</p>

<p>Mouse monoclonal PSMB9 antibody</p>

<p>The CCRL2 antibody is a highly specialized monoclonal antibody that belongs to the class of antibodies known as chimeric proteins. It exhibits cytotoxic properties and has been extensively studied in the field of Life Sciences. This antibody specifically targets endothelial growth factor receptors, inhibiting their activity and preventing the growth and proliferation of cells.</p>

<p>ARMCX6 antibody was raised using the N terminal of ARMCX6 corresponding to a region with amino acids TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW</p>

<p>Mouse monoclonal MHC Class I antibody (PE)</p>

<p>Pyrazolo(3,4-D)pyrimidine is a ligand that binds to Ion channels and can be used as a research tool for pharmacology. It has been shown to inhibit the activity of G protein-coupled receptors, including Ligand receptor interactions. Pyrazolo(3,4-D)pyrimidine is also an activator of the extracellular signal regulated kinases 1/2 (ERK1/2), which are signaling molecules involved in cell growth, differentiation and survival. This agent has been shown to activate the ERK1/2 pathway by binding to a specific sequence in the cytoplasmic domain of epidermal growth factor receptor (EGFR). Pyrazolo(3,4-D)pyrimidine is known as a high purity compound and has been shown to inhibit antibody production in some cases.</p>

<p>The LPL antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to target and bind to lipoprotein lipase (LPL), an enzyme involved in the breakdown of triglycerides. The LPL antibody is made using advanced polymerase chain techniques, ensuring high specificity and sensitivity.</p>

<p>Recombinant Human ASRGL1 protein</p>

<p>ELISA matched pair kit for detection of Human Factor VIII C in the research laboratory</p>

<p>Purified Rabbit polyclonal RNF144A antibody</p>

<p>Vitamin D Bovine Serum Albumin (BSA) Conjugate</p>

<p>RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF</p>

<p>WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen</p>

<p>CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA</p>

<p>C14ORF180 antibody was raised using the middle region of C14Orf180 corresponding to a region with amino acids PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG</p>

<p>The MCL1 antibody is a powerful tool in the field of immunology and biomedical research. This monoclonal antibody specifically targets the MCL1 protein, which plays a crucial role in cell survival and apoptosis regulation. The MCL1 antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Mouse monoclonal Gastric Mucin antibody</p>

<p>KIF3A antibody was raised using the C terminal of KIF3A corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR</p>

<p>CA3 antibody was raised in Rabbit using Human CA3 as the immunogen</p>

<p>Rabbit Polyclonal CDK9 antibody (Thr186)</p>

<p>LPHN3 antibody was raised in Rabbit using Human LPHN3 as the immunogen</p>

<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CHD6 antibody was raised in mouse using recombinant Human Chromodomain Helicase Dna Binding Protein 6 (Chd6)</p>

<p>RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD</p>

<p>Cystatin C protein is a vital component of the Proteins and Antigens group. It contains an amino group that plays a crucial role in various biological processes. This protein can be targeted using monoclonal antibodies for diagnostic purposes. Cystatin C protein has been studied extensively for its association with autoimmune disorders such as antiphospholipid antibodies and heparin-induced thrombocytopenia. It also interacts with other molecules like epidermal growth factor, caffeine, and fatty acids, affecting their functions. Additionally, cystatin C protein has been linked to interferon signaling pathways and β-catenin regulation. Its importance in low-density lipoprotein metabolism and anticoagulation has also been established in the field of Life Sciences.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target and treat tuberculosis infections. With its bactericidal activity, it effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been proven to be highly effective in human erythrocytes using the patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>ARC antibody was raised in rabbit using the N terminal of ARC as the immunogen</p>

<p>LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL</p>

<p>KIT antibody was raised in Rabbit using Human KIT as the immunogen</p>

<p>GJD4 antibody was raised using the middle region of GJD4 corresponding to a region with amino acids HTKIPDEDESEVTSSASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPS</p>

<p>Rabbit Polyclonal OR5M3 antibody</p>

<p>The SMP30 antibody is a highly specialized monoclonal antibody that is used in various assays within the Life Sciences field. This activated antibody is specifically designed to target transthyretin, an extracellular protein found in human serum. By immobilizing the SMP30 antibody on an electrode, it allows for the detection and quantification of transthyretin levels in samples. Additionally, this antibody has shown inhibitory effects on interferon activity, making it a valuable tool in immunological research and drug development. With its high specificity and sensitivity, the SMP30 antibody offers precise and reliable results for researchers in need of accurate protein analysis.</p>

<p>NFATc1 antibody was raised in mouse using recombinant human NFATc1 (428-716aa) purified from E. coli as the immunogen.</p>

<p>GOPC antibody was raised in Rabbit using Human GOPC as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it is highly effective in treating tuberculosis infections. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The Spectrin antibody is a highly specialized monoclonal antibody that targets activated spectrin, a protein involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications in adipose tissue growth regulation and hormone peptide signaling. It has also shown promise in the detection and neutralization of autoantibodies associated with certain autoimmune disorders. The Spectrin antibody works by binding to specific epitopes on spectrin, thereby inhibiting its interaction with other proteins such as calpain and annexin. This inhibition prevents abnormal cellular processes, including cytotoxicity and hemolysis, which are often observed in conditions like mycoplasma genitalium infection. With its high specificity and potency, the Spectrin antibody offers a valuable tool for researchers and clinicians studying spectrin-related diseases and developing targeted therapies.</p>