Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.104 produtos)
- Por Alvo Biológico(99.074 produtos)
- Por uso/Efeitos Farmacológicos(6.784 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.693 produtos)
- Metabólitos secundários(14.218 produtos)
Foram encontrados 130576 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-AMVSEFLKQAWFIENEEQEYVQTVK-OH
<p>Peptide Ac-AMVSEFLKQAWFIENEEQEYVQTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPEGVPPLLVSQQAK^-OH
<p>Peptide H-DPEGVPPLLVSQQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSMVVIPTYALHHDPK^-OH
<p>Peptide H-GSMVVIPTYALHHDPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-PKPPKPVSKMRMATPLLMQA-OH
<p>Peptide Biot-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QVSSHIQVLAR^-OH
<p>Peptide H-QVSSHIQVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pureza:Min. 95%H-ELVVDFLSYK^-OH
<p>Peptide H-ELVVDFLSYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
<p>Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).</p>C.I.Reactive Red 111
CAS:<p>C.I.Reactive Red 111 is a reactive dye that can be used in the manufacture of textile and paper products. It has been shown to have optimum reactivity with anionic groups, such as sulfonic acid and carboxylate, at pH levels between 2-11. This dye has a wide range of application parameters, including stability and color development time. C.I.Reactive Red 111 is also resistant to oxidation by sulfuric acid and other corrosive chemicals at high concentrations, which makes it suitable for use in industrial environments where strong oxidizing agents are present.</p>Pureza:Min. 95%H-EGIEEEGGEQDKDRS-OH
<p>H-EGIEEEGGEQDKDRS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EGIEEEGGEQDKDRS-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EGIEEEGGEQDKDRS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EGIEEEGGEQDKDRS-OH at the technical inquiry form on this page</p>Pureza:Min. 95%H-ELHHLQEQNVSNA^FLDK^-OH
<p>Peptide H-ELHHLQEQNVSNA^FLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNGLVTGTR^-OH
<p>Peptide H-YNGLVTGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SLV-NH2
<p>Peptide Ac-SLV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GNTDLYKRLQSSDYC-NH2
<p>Ac-GNTDLYKRLQSSDYC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-GNTDLYKRLQSSDYC-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-GNTDLYKRLQSSDYC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-GNTDLYKRLQSSDYC-NH2 at the technical inquiry form on this page</p>Pureza:Min. 95%H-IMYNYPAM-OH
<p>Peptide H-IMYNYPAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fórmula:C46H65N9O11S2Cor e Forma:PowderPeso molecular:1,002.21 g/molYM155
CAS:<p>A novel survivin suppressant with an IC50 of 0.54 nM for the negative regulation of the survivin promoter.</p>Fórmula:C20H19BrN4O3Pureza:Min. 95%Cor e Forma:Off-White PowderPeso molecular:443.29 g/molHSP70 protein (His tag)
<p>1-641 amino acids: MGSSHHHHHH SSGLVPRGSH MAKAAAIGID LGTTYSCVGV FQHGKVEIIA NDQGNRTTPS YVAFTDTERL IGDAAKNQVA LNPQNTVFDA KRLIGRKFGD PVVQSDMKHW PFQVINDGDK PKVQVSYKGD TKAFYPEEIS SMVLTKMKEI AEAYLGYPVT NAVITVPAYF NDSQRQATKD AGVIAGLNVL RIINEPTAAA IAYGLDRTGK GERNVLIFDL GGGTFDVSIL TIDDGIFEVK ATAGDTHLGG EDFDNRLVNH FVEEFKRKHK KDISQNKRAV RRLRTACERA KRTLSSSTQA SLEIDSLFEG IDFYTSITRA RFEELCSDLF RSTLEPVEKA LRDAKLDKAQ IHDLVLVGGS TRIPKVQKLL QDFFNGRDLN KSINPDEAVA YGAAVQAAIL MGDKSENVQD LLLLDVAPLS LGLETAGGVM TALIKRNSTI PTKQTQIFTT YSDNQPGVLI QVYEGERAMT KDNNLLGRFE LSGIPPAPRG VPQIEVTFDI DANGILNVTA TDKSTGKANK ITITNDKGRL SKEEIERMVQ EAEKYKAEDE VQRERVSAKN ALESYAFNMK SAVEDEGLKG KISEADKKKV LDKCQEVISW LDANTLAEKD EFEHKRKELE QVCNPIISGL YQGAGGPGPG GFGAQGPKGG SGSGPTIEEV D</p>Pureza:>95% By Sds-Page.H-AL^P^AP^IEK^-OH
<p>Peptide H-AL^P^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PLP (178-191)
CAS:<p>PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).</p>Fórmula:C70H106N18O22SPeso molecular:1,583.8 g/molH-DPIYFTGLASEPGAR^-OH
<p>Peptide H-DPIYFTGLASEPGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSLEIEQLELQR^-OH
<p>Peptide H-LSLEIEQLELQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGEIEGFR^-OH
<p>Peptide H-GGEIEGFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^FF-OH
<p>Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDEEHPK-OH
<p>H-ILDEEHPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ILDEEHPK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ILDEEHPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ILDEEHPK-OH at the technical inquiry form on this page</p>Pureza:Min. 95%H-GLNEEIAR^V-OH
<p>Peptide H-GLNEEIAR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAVVRTPPK^-OH
<p>Peptide H-VAVVRTPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RGGGGLGLGK-NH2
<p>Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLDLSNVQSK^-OH
<p>Peptide H-KLDLSNVQSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPL^TATLSK^-OH
<p>Peptide H-TPL^TATLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CDREELFGEQSGKPNR-NH2
<p>Ac-CDREELFGEQSGKPNR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CDREELFGEQSGKPNR-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CDREELFGEQSGKPNR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CDREELFGEQSGKPNR-NH2 at the technical inquiry form on this page</p>Pureza:Min. 95%CRP protein
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>Pureza:Purity >99% (By Sds-Page And Electrophoresis).H-QWHEDITQDLR^-OH
<p>Peptide H-QWHEDITQDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGALNSNDAFVLK^-OH
<p>Peptide H-AGALNSNDAFVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPDEDLAGLR^-OH
<p>Peptide H-IPDEDLAGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CA 15-3 Grade II (Low Cross-reactivity), Part Purified
<p>CA 15-3 Grade II (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 15-3 Grade II (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Tolterodine tartrate - Bio-X ™
CAS:<p>Tolterodine is a muscarinic antagonist drug that is used for the treatment of an overactive bladder and its conditions associated with that such as urine urgency and incontinence. This drug act as an antagonist at muscarinic receptors which results in inhibition of bladder contraction, decrease in detrusor pressure, and an incomplete emptying of the bladder.</p>Fórmula:C22H31NO·C4H6O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:475.57 g/molOxaliplatin - Bio-X ™
CAS:<p>Oxaliplatin is a platinum-based DNA-cross-linking agent. It is a chemotherapeutic drug, often used in combination with leucovorin, fluorouracil, and capecitabine. Oxaliplatin works by cross-linking DNA thus inhibiting the synthesis of RNA and proteins, which leads to cell death and inhibition of cancer cells growth. It is more effective than cisplatin or irinotecan in treating metastatic cancer. Oxaliplatin also has effects on Toll-like receptor 4 (TLR4) expression levels in vitro and in vivo models. In addition, oxaliplatin's effect on ATP binding cassette transporter proteins may be responsible for its antitumour activity against solid tumours.<br>Oxaliplatin is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>Fórmula:C8H14N2O4PtPureza:Min. 98 Area-%Cor e Forma:White PowderPeso molecular:397.29 g/molPrEST Antigen TAS2R39
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:21 g/molKisspeptin-13 (human)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C78H107N21O18Peso molecular:1,626.84 g/molAnti-JAK3 antibody R2G - 1mg/mL
<p>Ligand binding to type I receptors with a common subunit gamma result in local cytoplasmic Jak3 being recruited to the cytoplasmic tails of the receptor. The tail becomes phosphorylated creating STAT protein binding sites. The STAT complex then also becomes phosphorylated to form a homo/heterodimer and translocate to the nucleus to bind to DNA to activate transcription. For example, interleukin IL2 binds type I receptor ILR2 resulting in Jak1 with Jak3 recruitment to the cytoplasmic gamma subunit. This interaction leads to tyrosine phosphorylation of the receptor for Stat5A with Stat5B docking. These STATs are then phosphorylated and activated by Jak1 and Jak3 leading to their dimerization and translocation for activation of specific gene transcription.Jak3 also has vital roles in immune cell signalling pathways; IL2 binds IL2R on T cells and natural killer cells. It has been found that in these immune cells Jak3 is critical to facilitate tyrosine phosphorylation of the cytoplasmic IL2R subunit. Throughout T cell differentiation Jak3 is required for IL7 induced activation of IL7R to activate PI3k and STATs. Ablation of Jak3 completely halted T cell proliferation. JAK3-deficient models have phenotypes like human severe combined immunodeficiency (SCID), due to the lack of developed lymphocytes. This was linked to the interaction found between Jak3 and the T cell protein tyrosine phosphatases (TCPTP) key to cytokine signalling in haematopoietic cells.</p>H-HEIPVLP^NR-OH
<p>Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-ADEYLIPQQ-OH
<p>Peptide LCBiot-ADEYLIPQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDYHPRDHTATWGGG-NH2
<p>Peptide H-RDYHPRDHTATWGGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELNEALELK^-OH
<p>Peptide H-ELNEALELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Gln53)-Connexin 37 (51-58) (human, mouse, rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C40H59N11O15Peso molecular:933.97 g/molH-SEQSDLSFSK^-OH
<p>Peptide H-SEQSDLSFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYY^TSR^-OH
<p>Peptide H-LLIYY^TSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CAT-NH2
<p>Peptide Ac-CAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin I (1-9)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C56H78N16O13Peso molecular:1,183.35 g/molH-SLSAPGNLLTK^-OH
<p>Peptide H-SLSAPGNLLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
