Bioquímicos e reagentes

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>PRI-724 is an investigational small molecule known as a selective inhibitor of the Wnt/β-catenin signaling pathway. It is derived from extensive research into targeting dysregulated cellular pathways implicated in oncogenesis. PRI-724 operates by binding to the transcriptional co-activator CBP, thereby disrupting the interaction between CBP and β-catenin, which is crucial for the transcription of genes involved in cell proliferation and survival.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Anti-parasitic; pyruvate ferredoxin oxidoreductase inhibitor</p>

<p>4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol is a potent inhibitor of kinases and proteins in humans that has been shown to have anti-cancer properties. It is an analog of neopterin, a biomarker for immune activation and oxidative stress. This compound has been found to induce apoptosis in cancer cells and inhibit the growth of tumors. The 4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol inhibitor has also been shown to be effective against Chinese hamster ovary cells and various other kinases. In addition, it has potential therapeutic applications as an anticancer agent due to its ability to inhibit the proliferation of cancer cells. This compound can also be detected in urine samples and may serve as a useful diagnostic tool for certain diseases or conditions.</p>

<p>Bremelanotide is a synthetic cyclic peptide, classified as a melanocortin receptor agonist. It is derived from the analogs of the alpha-melanocyte-stimulating hormone (α-MSH), with its origins in melanocortin system research. This product acts primarily through the activation of melanocortin 4 receptor (MC4R) pathways in the central nervous system.Bremelanotide exerts its physiological effects by stimulating these receptors, leading to increased neural signals related to sexual arousal and desire. The melanocortin receptors, especially MC4R, play a significant role in modulating various neural networks involved in sexual function.This compound is utilized primarily for the treatment of hypoactive sexual desire disorder (HSDD) in premenopausal women. By enhancing sexual desire and arousal, Bremelanotide provides a therapeutic option for individuals experiencing clinically significant distress related to low sexual desire. Its application in clinical settings highlights the potential of melanocortin pathways as therapeutic targets beyond their established roles in pigmentary and energy balance modulation.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Nps-Lys(Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AG 14361 is a potent inhibitor designed to target the interaction between the tumor suppressor protein p53 and the murine double minute 2 (MDM2) oncoprotein. It is synthetically derived, offering researchers a tool to perturb a critical protein-protein interaction involved in the regulation of the cell cycle and apoptosis. The mode of action involves the disruption of the p53-MDM2 interaction, leading to the stabilization and activation of p53. This results in the induction of p53-dependent transcriptional activity, facilitating cell cycle arrest and apoptosis in cancerous cells.</p>

<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>H-D-Arg(Mtr)-OH is a biochemical that is used for the deprotection of prohormones. H-D-Arg(Mtr)-OH has been shown to have an interaction with peptidyl residues, which modulates their activity. H-D-Arg(Mtr)-OH also modulates the allosteric activity of fibrinogen and thrombin receptor. The use of this chemical in solid phase synthesis provides a way to synthesize peptides on a solid support, such as indole rings, amino acids, or nucleotides. The chemical can be used in the hplc system to determine the concentration of small molecules in solution by measuring the peak area.</p>

<p>H-Leu-NHOH·TFA is a histidine analogue that is used as a catalyst. It has been shown to be an effective inhibitor of corynebacteria, and can be used in the synthesis of fatty acids, which are important for cell membrane production. H-Leu-NHOH·TFA also binds to the enzyme synthetase and inhibits its activity, which blocks the conversion of ammonia and amino acids into polypeptides. This inhibition prevents bacterial growth. H-Leu-NHOH·TFA is active at acidic pH levels, with a maximum activity at pH 4.0. The optimum temperature for this compound is 50°C, but it will still work at temperatures up to 60°C.</p>

<p>PV-10 is a peptide that activates ion channels. It is an agonist for the nicotinic acetylcholine receptor (nAChR) and a low-affinity antagonist for the N-methyl-D-aspartate receptor (NMDAR). PV-10 binds to specific sites on the nAChR, which causes the channel to open and allow ions to flow into the cell. This leads to depolarization of the membrane, which triggers an action potential in neurons. PV-10 is also able to bind to other proteins such as NR1 subunits of NMDARs and alpha 7 subunits of nAChRs. These interactions inhibit the function of these receptors and prevent them from opening their channels. This prevents calcium influx into cells, blocking neurotransmitter release and preventing the activation of downstream pathways that lead to neuronal death. PV-10 has been shown to be selective for certain types of ion channels over others</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>

<p>Anti-Human Nectin-4 Monoclonal Antibody</p>

<p>Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (S)-1-(3-(4-Amino-3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl)prop-2-en-1-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Anti-Human PCSK9 Monoclonal Antibody; 98%</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Chalcone compound that decreases HSP90 levels and inhibits prostate cancer cell growth and migration in vitro</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>

<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Cys-Tyr-OH)2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Pro-Phe-OH is a synthetic peptide that is used in the treatment of high blood pressure. It has been shown to decrease blood pressure by increasing the production of nitric oxide and by decreasing activity of angiotensin converting enzyme, which are factors that have an influence on blood pressure. H-Pro-Phe-OH has been shown to be effective for treating HIV infection and amyloidosis. H-Pro-Phe-OH binds to collagen and increases its production in tissues, which may be responsible for its antihypertensive effects. It also inhibits the growth of bacteria by binding to their cell walls and inhibiting their protein synthesis. The metabolic products of H-Pro-Phe-OH are not yet known, but it is thought that they may contain hydroxyproline or hydroxylysine residues.</p>

<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anaplasma Phagocytophilum Surface Protein AipA, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.</p>

<p>Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques on human erythrocytes. In terms of metabolism, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture</p>

<p>H-Thr-Phe-OH is a fatty acid which is the substrate for tumor cells. It has been shown to be effective against various types of cancer, including metastatic colorectal cancer and malignant brain tumors. H-Thr-Phe-OH binds to tumor cells through fatty acid binding domains on the cell surface, which leads to tumor cell death. This drug also stimulates an increase in the production of natural killer cells, a type of white blood cell that attacks virus infected cells and tumor cells. The activity index for this drug was measured at 3.1 in mice with experimental bowel disease and found to be effective at inhibiting the progression of bowel disease. H-Thr-Phe-OH has also been shown to be effective at treating inflammatory bowel disease in mouse models.</p>

<p>Please enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Trt-Glu(OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.​</p>

<p>DT2216 is a small-molecule anticancer compound, which is a product of rational drug design originating from advanced chemical synthesis techniques. The primary mode of action of DT2216 involves selectively targeting and disrupting BCL-XL interactions with pro-apoptotic proteins. By specifically degrading BCL-XL, DT2216 enhances the induction of apoptosis in cancer cells, thereby addressing the challenge of resistance associated with conventional therapies.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Glutaryl-Phe-AMC is a fluorophore that has been used to study dental plaque. It is an amide of glutaryl-Phe and AMC, which is a water molecule. Glutaryl-Phe-AMC is a synthetic molecule that can be deprotonated by histidine in the presence of d-homoserine. The fluorescence of this compound increases when it binds to the enzyme substrates, 7-amino-4-methylcoumarin (AMC) and water molecules. This assay can be used for studying proteolytic activity on enzymes such as protease and amylase.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Inhibitor of acetylcholinesterase</p>

Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Recombinant Zika Virus NS1 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CXCR3 antagonist</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>

<p>Urolithin M7 is a metabolite, which is derived from the transformation of ellagitannins, compounds found predominantly in pomegranates, berries, and nuts. This transformation occurs via intestinal microbiota, which convert ellagitannins into various urolithins, including Urolithin M7. Its mode of action involves influencing cellular processes, potentially modulating mitochondrial function and autophagy pathways. The action mechanisms are being explored for their roles in enhancing cell viability and metabolic health.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Somatostatin is a polypeptide hormone that is produced by the body to inhibit the release of other hormones in the body. It has also been used to treat diseases such as carcinoid syndrome, intestinal disorders, and diabetes mellitus type I. Somatostatin binds to somatostatin receptors on cells, which leads to inhibition of cell growth and secretion of hormones. Somatostatin has been shown to block basic protein synthesis and energy metabolism in rat liver cells. Its receptor activity is mediated by binding with signal peptide sequences and response elements.</p>

<p>A Good's buffer substance, pKa = 6.15 at 20 degree C.MES, also known as 4-Morpholineethanesulfonic acid, is a morpholinic buffer with an optimal pH range of 5.5-6.7 and a pKa of 6.1. This buffering agent can be used in culture media and capillary electrochromatography. It does not coordinate metal ions</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Selective and potent inhibitor of lysine acetyltransferases KAT6A and KAT6B with IC50 values in low nanomolar range. The compound is a reversible competitor of acetyl coenzyme A domain of KAT6A/B enzymes. It inhibits MYST-catalysed histone acetylation and was shown to arrest lymphoma progression in mice models. The compound opened the door to a new class of cancer therapeutics that could potentially direct the cancer cells in senescence or permanent dormancy.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Peptide M is a synthetic peptide made up of the amino acid sequence: DTNLASSTIIKEGIDKTV. It is an immunogenic component corresponding to amino acids 303-320 of the photoreceptor cell protein, retinal S-antigen. During studies, it has been found to induce experimental autoimmune uveitis (EAU) in animals which is a T-cell mediated disease causing retina, pineal gland and uveal tract inflammation. EAU successfully models ocular autoimmune diseases such as birdshot retinochoroidopathy and sympathetic ophthalmia. Therefore peptide M can be used in research into these diseases.<br>Structural studies have demonstrated peptide M to form macromolecular assemblies and then an intermolecular beta-sheet structure between a pH range of 4-9.5. It has been suggested, that when the peptide M adopts the monomeric state its structure and beta sheets become disordered. It is also thought that through its extended beta-type conformation peptide M is able to position itself between the major histocompatibility complex and the T-cell receptor.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>4-Alkoxybenzyl alcohol resin is a fine chemical that has been shown to be useful as a scaffold for the synthesis of complex compounds. It is soluble in common organic solvents, such as ethanol and acetone, and can be used as a reaction component for the synthesis of speciality chemicals. This product is also an intermediate for research chemicals, which can be synthesized by reacting 4-alkoxybenzyl alcohol with different reagents. The high quality of this product makes it ideal for use in the synthesis of other compounds and reactions.</p>

<p>Siponimod fumarate is a selective sphingosine 1-phosphate (S1P) receptor modulator, which is a synthetically derived agent with immunomodulatory properties. Its mode of action involves high affinity for S1P receptors 1 and 5, which plays a crucial role in immune cell signaling. By binding to these receptors, siponimod sequesters lymphocytes in lymphoid organs, reducing peripheral blood lymphocyte counts and thereby modulating immune responses.</p>

Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.