Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.104 produtos)
- Por Alvo Biológico(99.074 produtos)
- Por uso/Efeitos Farmacológicos(6.784 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.693 produtos)
- Metabólitos secundários(14.218 produtos)
Foram encontrados 130576 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>Pureza:Min. 95%Mouse PGD2 ELISA kit
<p>ELISA Kit for detection of PGD2 in the research laboratory</p>Pureza:Min. 95%Human Ceruloplasmin ELISA Kit
<p>Human Ceruloplasmin ELISA kit is intended for the quantitative determination of total human ceruloplasmin in biological samples.</p>Pureza:Min. 95%Influenza A Calibration Kit
<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>Pureza:Min. 95%Mouse IL16 ELISA kit
<p>ELISA Kit for detection of IL16 in the research laboratory</p>Pureza:Min. 95%Pig Haptoglobin ELISA Kit
<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Pureza:Min. 95%Hamster CHO PLBL2 ELISA Kit
<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>Pureza:Min. 95%Human IL25 ELISA kit
<p>ELISA Kit for detection of IL25 in the research laboratory</p>Pureza:Min. 95%Mouse IgA ELISA Kit
<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Mouse MMP3 ELISA Kit
<p>ELISA Kit for detection of MMP3 in the research laboratory</p>Pureza:Min. 95%FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Pureza:Min. 95%Human PGF2a ELISA kit
<p>ELISA Kit for detection of PGF2a in the research laboratory</p>Pureza:Min. 95%Mouse Leptin Receptor ELISA kit
<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>Pureza:Min. 95%Human CX3CL1 ELISA Kit
<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>Pureza:Min. 95%Histamine ELISA Kit
<p>Histamine ELISA Kit for the quantitative determination of Histamine in plasma and urine</p>Pureza:Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Pureza:Min. 95%Human MMP1 ELISA Kit
<p>ELISA kit for detection of MMP1 in the research laboratory</p>Pureza:Min. 95%Pregnenolone ELISA kit
<p>ELISA kit for the detection of Pregnenolone in the research laboratory</p>Pureza:Min. 95%H+K+ ATPase antibody
<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>C1ORF131 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>Pureza:Min. 95%(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione
CAS:<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>Fórmula:C36H38O8Pureza:Min. 95%Peso molecular:598.7 g/molRef: 3D-WZB30491
Produto descontinuadoβ-Sinensal
CAS:<p>β-Sinensal is an analog of astaxanthin that has shown potent inhibitory activity against human kinases. This compound has been shown to induce apoptosis in cancer cells and inhibit tumor growth in Chinese hamsters. β-Sinensal has also been found in human urine, suggesting that it may have a role in regulating cellular replication. In addition, this compound has demonstrated synergistic effects with methotrexate, a commonly used cancer drug. β-Sinensal is a promising inhibitor of kinases and may have potential as a therapeutic agent for the treatment of cancer.</p>Fórmula:C15H22OPureza:Min. 95%Peso molecular:218.33 g/molRef: 3D-KCA06688
Produto descontinuadoCoronavirus (SARS-CoV-2) Nucleoprotein - Purified
<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>Pureza:Min. 95%Hamster (CHO) Glutathione S-Transferase P - ELISA Kit
<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>Pureza:Min. 95%Coronavirus (SARS-CoV-2) Spike S1 RBD - Purified from HEK 293
<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>Bestatin-amido-Me
CAS:<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>Fórmula:C17H27N3O3Pureza:Min. 95%Peso molecular:321.4 g/molRef: 3D-PNA18654
Produto descontinuadoGRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%Human Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Pureza:Min. 95%Rabbit Prostaglandin E2 ELISA kit
<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>Pureza:Min. 95%Human VEGFR2 ELISA Kit
<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>Pureza:Min. 95%Porcine IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Pureza:Min. 95%Mouse MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Pureza:Min. 95%HRP-IgG Conjugation Kit
<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>Pureza:Min. 95%Chlamydia Pneumoniae IgA ELISA kit
<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>Pureza:Min. 95%Rat Lipocalin 2 ELISA Kit
<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>Pureza:Min. 95%Human EGFR ELISA Kit
<p>ELISA kit for detection of EGFR in the research laboratory</p>Pureza:Min. 95%Mouse Free Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>Pureza:Min. 95%Mouse RANKL ELISA Kit
<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>Pureza:Min. 95%Rat PAI1 ELISA Kit
<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>Pureza:Min. 95%IgG1 κ Isotype Control Fc fusion protein (PE)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>Pureza:Min. 95%Mouse BAFF ELISA Kit
<p>ELISA kit for detection of BAFF in the research laboratory</p>Pureza:Min. 95%Gliadin IgA ELISA kit
<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>Pureza:Min. 95%Human CD40L ELISA Kit
<p>ELISA kit for detection of CD40 in the research laboratory</p>Pureza:Min. 95%Human Fibronectin ELISA kit
<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>Pureza:Min. 95%Human ICAM1 ELISA kit
<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>Pureza:Min. 95%IgG1 κ Isotype Control antibody (Biotin)
<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>Pureza:Min. 95%Annexin V ELISA kit
<p>ELISA kit for the detection of Annexin V in the research laboratory</p>Pureza:Min. 95%Human Complement C3a des Arg ELISA kit
<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>Pureza:Min. 95%Human Leptin ELISA kit
<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>Pureza:Min. 95%Progesterone ELISA Kit
<p>ELISA kit for detection of Progesterone in the research laboratory</p>Pureza:Min. 95%Human Lipocalin 2 ELISA kit
<p>ELISA kit for the detection of NGAL in the research laboratory</p>Pureza:Min. 95%Estradiol ELISA kit
<p>ELISA kit for the detection of Estradiol in the research laboratory</p>Pureza:Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Pureza:Min. 95%Gliadin IgG ELISA kit
<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>Pureza:Min. 95%Mouse Neurotrophin 3 ELISA Kit
<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>Pureza:Min. 95%Parietal Cell ELISA kit
<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>Pureza:Min. 95%Rat PPARa ELISA kit
<p>ELISA Kit for detection of PPARa in the research laboratory</p>Pureza:Min. 95%Adrenaline/Noradrenaline ELISA Kit (2-CAT)
<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>Pureza:Min. 95%α Fodrin ELISA kit
<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>Pureza:Min. 95%Serotonin ELISA Kit
<p>ELISA kit for detection of Serotonin in the research laboratory</p>Pureza:Min. 95%Rheumatoid Factor IgM ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>Pureza:Min. 95%Rat Histamine ELISA kit
<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>Pureza:Min. 95%PBB 10
CAS:<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>Fórmula:C12H8Br2Pureza:Min. 95%Peso molecular:312 g/molRef: 3D-JCA08032
Produto descontinuadoHistamine release ELISA kit
<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>Pureza:Min. 95%Rubella ELISA Kit
<p>ELISA kit for detection of Rubella in the research laboratory</p>Pureza:Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Phospholipid Screen IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>Pureza:Min. 95%Human Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Azido-dPEG®3-Amine
CAS:<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:218.25 g/molChicken Ovotransferrin (Conalbumin) ELISA Kit
<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>Pureza:Min. 95%Monkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Pureza:Min. 95%Human IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Pureza:Min. 95%Rat A2M ELISA Kit
<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Pig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Pureza:Min. 95%Dog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Pureza:Min. 95%
