Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Dusp11 antibody, catalog no. 70R-8479</p>

<p>Purified Polyclonal mGLUR4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK1 antibody, catalog no. 70R-5220</p>

<p>1-335 amino acids: MGKVKVGVNG FGRIGRLVTR AAFNSGKVDI VAINDPFIDL NYMVYMFQYD STHGKFHGTV KAENGKLVIN GNPITIFQER DPSKIKWGDA GAEYVVESTG VFTTMEKAGA HLQGGAKRVI ISAPSADAPM FVMGVNHEKY DNSLKIISNA SCTTNCLAPL AKVIHDNFGI VEGLMTTVHA ITATQKTVDG PSGKLWRDGR GALQNIIPAS TGAAKAVGKV IPELNGKLTG MAFRVPTANV SVVDLTCRLE KPAKYDDIKK VVKQASEGPL KGILGYTEHQ VVSSDFNSDT HSSTFDAGAG IALNDHFVKL ISWYDNEFGY SNRVVDLMAH MASKE</p>

<p>Purified Polyclonal RAB33A antibody</p>

<p>GSK3 beta protein is a target molecule in the field of Life Sciences. It belongs to the family of lectins, which are proteins that bind to specific carbohydrates. GSK3 beta protein has been studied extensively for its role in various biological processes, including cell signaling and regulation of gene expression. It has been shown to interact with a wide range of proteins and antigens, including interferon and metal-binding proteins.</p>

<p>CXCL14 antibody was raised in rabbit using the middle region of CXCL14 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC7 antibody, catalog no. 70R-1337</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VDR antibody, catalog no. 70R-1930</p>

<p>Purified Polyclonal DIO3 antibody</p>

<p>cAMP Conjugate for use in immunoassays</p>

<p>BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA</p>

<p>SLC12A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3A antibody, catalog no. 70R-2159</p>

<p>Purified recombinant Human DIRAS1 protein</p>

<p>Rabbit Polyclonal MAPKAPK2 antibody (Thr334)</p>

<p>The PNMT antibody is a highly specific monoclonal antibody that targets the phenylethanolamine N-methyltransferase (PNMT) enzyme. This enzyme is responsible for the conversion of norepinephrine to epinephrine, a process that plays a crucial role in various physiological functions. The PNMT antibody has been extensively studied and validated for its use in research and diagnostic applications.</p>

<p>PPC-NHS ester is a monoclonal antibody that binds to the peptide sequence, C-CK-Tyr-Gly-Phe, in the antigen. It is used as an immunoconjugate for the treatment of cancer and diagnostic purposes. PPC-NHS ester has been shown to have anticancer activity in vitro assays with human breast cancer cells. The antibody also has diagnostic value because it can be used to detect the tumor marker CA19-9 in clinical samples. This antibody is a polymerase chain reaction product from a mouse hybridoma cell line and contains signal sequences at its N terminus.</p>

<p>GIMAP7 antibody was raised in Rabbit using Human GIMAP7 as the immunogen</p>

<p>ALDH9A1 antibody was raised in rabbit using the C terminal of ALDH9A1 as the immunogen</p>

<p>ANGPTL2 antibody was raised in Rabbit using Human ANGPTL2 as the immunogen</p>

<p>Ercc1 antibody was raised in rabbit using the C terminal of Ercc1 as the immunogen</p>

<p>The CDC42 antibody is a highly specific monoclonal antibody that is used in bioassays to detect and analyze the presence of CDC42, an important oncogene homolog. This antibody is designed to target the CDC42 protein, which plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. The CDC42 antibody has been extensively tested and validated for its specificity and sensitivity in detecting CDC42 in human serum samples. It can be used in research studies investigating the involvement of CDC42 in cancer development and progression. Additionally, this antibody has shown potential as a diagnostic tool for detecting elevated levels of CDC42 in certain types of cancer, such as alpha-fetoprotein-positive hepatocellular carcinoma. Its high affinity and selectivity make it a valuable tool for researchers studying signal transduction pathways involving CDC42 or investigating therapeutic targets related to this protein.</p>

<p>Mouse monoclonal SERPINB4 antibody</p>

<p>Purified  Type 6 Adenovirus protein</p>

<p>Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.</p>

<p>N1-Hydroxy-N8-[4-[4-[(1-oxo-5-hexyn-1-yl)amino]benzoyl]phenyl]-octanediamide is a molecule with chemical structure of a benzamide. It has been shown to have inhibitory properties against histone deacetylase (HDAC), an enzyme that regulates gene expression by removing acetyl groups from the lysine residues in histones. The compound was found to be an estrogen receptor modulator and inhibits the growth of cancer cells in culture. In rat cardiomyocytes, it increased contractility and inhibited calcium uptake. N1-Hydroxy-N8-[4-[4-[(1-oxo-5-hexyn-1-yl)amino]benzoyl]phenyl]-octanediamide binds to the protein target HDAC2, which is associated with breast cancer progression, highlighting its potential as a therapeutic drug for</p>

<p>Hexestrol p-OH Conjugate for use in immunoassays</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Affinity purified Rabbit polyclonal TR alpha antibody</p>

<p>PSME1 antibody was raised using the middle region of PSME1 corresponding to a region with amino acids KEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEI</p>

<p>Rabbit polyclonal Peroxiredoxin 1 antibody (FITC)</p>

<p>Rabbit polyclonal WBSCR17 antibody</p>

<p>Rabbit polyclonal GATA4 antibody (Ser262)</p>

<p>Junctophilin 3 antibody was raised using the N terminal of JPH3 corresponding to a region with amino acids SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG</p>

<p>The MAOA antibody is a highly specific and potent inhibitor of the enzyme monoamine oxidase A (MAOA). This antibody binds to the active site of MAOA, preventing its enzymatic activity. MAOA plays a crucial role in the metabolism of histamine, serotonin, and other neurotransmitters, making it an important target for therapeutic interventions. The MAOA antibody has been extensively studied in various research areas, including neuroscience, oncology, and immunology.</p>

<p>Purified Polyclonal PIGX antibody</p>

<p>CYP46A1 antibody was raised using the C terminal of CYP46A1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF585B antibody, catalog no. 70R-8118</p>

<p>The EDG5 antibody is a polyclonal antibody that specifically targets the EDG5 receptor. This receptor plays a crucial role in various biological processes, including cell proliferation, migration, and survival. The EDG5 antibody has been shown to effectively block the binding of its ligands and inhibit downstream signaling pathways.</p>

<p>MAPK15 antibody was raised using the middle region of MAPK15 corresponding to a region with amino acids GHDPAEHESPRAAKNVPRQNSAPLLQTALLGNGERPPGAKEAPPLTLSLV</p>

<p>The HDAC5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets atypical hemolytic autoantibodies. This antibody has neutralizing properties, meaning it can inhibit the activity of these autoantibodies, preventing them from causing damage to red blood cells. The HDAC5 antibody is produced using state-of-the-art techniques and has been extensively tested for its efficacy and specificity.</p>

<p>The PANX1 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of antibodies known as globulins and has been extensively studied for its role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRMT11 antibody, catalog no. 70R-2110</p>

<p>TAS0728 is an experimental drug that has potent antitumor activity and may be used for the treatment of cancer. TAS0728 does not have any known adverse effects on healthy cells, but it does have a potent effect on activated cardiac myocytes. TAS0728 has been shown to inhibit receptor-mediated signaling by blocking the epidermal growth factor (EGF) receptor, which may cause cancer resistance or growth factor. TAS0728 also blocks the epidermal growth factor (EGF), which can lead to cancer cell proliferation and increased tumor size. The powder diffraction spectrum of TAS0728 shows that it is composed of crystalline material with a molecular weight of 578.6 g/mol.</p>

<p>Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW</p>

<p>PECAM1 protein is a human serum protein that plays a crucial role in various biological processes. It is commonly used as a target for monoclonal antibody research and has been extensively studied in the field of Life Sciences. PECAM1 protein is known to be activated by TNF-α and can interact with other proteins such as fibrinogen, chemokines, and interleukin-6.</p>

<p>ZNF397 antibody was raised in rabbit using the middle region of ZNF397 as the immunogen</p>

<p>Rabbit polyclonal GFAP antibody (Prediluted for IHC)</p>

<p>ENO2 antibody was raised in rabbit using the N terminal of ENO2 as the immunogen</p>

<p>Rabbit polyclonal AZI2 antibody</p>

<p>Purified Polyclonal IFNGR1 antibody</p>

<p>CLDN3 antibody was raised in Rabbit using Human CLDN3 as the immunogen</p>

<p>m-dPEG®36-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, m-dPEG®36-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNF4A antibody, catalog no. 70R-2034</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-3776</p>

<p>The AKR1C3 antibody is a reactive antibody used in Life Sciences research. It can be used as both a polyclonal and monoclonal antibody. This antibody is commonly used to detect autoantibodies in human serum samples. It specifically targets AKR1C3, an enzyme that plays a role in hormone metabolism and has been implicated in various diseases, including cancer.</p>

<p>Rabbit polyclonal RND2 antibody</p>

<p>MMP26 antibody was raised in rabbit using the C terminal of MMP26 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LAMP3 antibody, catalog no. 70R-7455</p>

<p>MTIF3 antibody was raised in Rabbit using Human MTIF3 as the immunogen</p>

<p>sAJM589 is a bifunctional molecule that contains an active methylene group and a photophysical group. In the presence of acid, its fluorescence is enhanced, which may lead to skin cancer. Specifically, sAJM589 has been shown to be cytotoxic in both cancer cells and normal cells. It also induces apoptosis in cancer cells by inhibiting DNA synthesis, protein synthesis, and cell proliferation. The functional theory of this molecule is not yet clear but it may be related to the metal ion binding properties of the molecule.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RTN1 antibody, catalog no. 70R-6578</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VIM antibody, catalog no. 70R-2952</p>

<p>PTX3 antibody was raised using the N terminal of PTX3 corresponding to a region with amino acids RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL</p>

<p>The SOCS2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets fatty acid, e-cadherin, and insulin antibodies. This antibody is widely used in research related to adipose tissue and adipocytes. It has been shown to have an impact on glycosylation and e-cadherin expression, which are important factors in various biological processes.</p>

<p>MGMT protein is a drug antibody that plays a crucial role in DNA repair and protection against alkylating agents. It is involved in the removal of alkyl groups from the O6 position of guanine, preventing the formation of DNA adducts and subsequent mutations. MGMT protein can be detected using polymerase chain reaction (PCR) or immunohistochemistry techniques. It has been shown to interact with lectins and carbonic anhydrases, suggesting its involvement in glycosylation processes and cellular metabolism. Activated MGMT protein undergoes glycan modifications, which make it more reactive and capable of binding to anti-ganglioside antibodies. In Life Sciences research, recombinant MGMT proteins are commonly used as antigens for studying immune responses and developing therapeutic strategies. Additionally, MGMT protein has been found to have natriuretic and cytotoxic effects on human hepatocytes, indicating its potential role in liver physiology and disease.</p>

<p>MPG antibody was raised in Rabbit using Human MPG as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1704 antibody, catalog no. 70R-4073</p>

<p>Pipernonaline is a bioactive phytochemical that has been shown to inhibit the growth of prostate cancer cells by mitochondrial membrane depolarization. It also inhibits the production of growth factors and cytokines, which may be due to its ability to inhibit the activity of tyrosinase and protein kinase C. Pipernonaline has potent inhibitory activity against infectious diseases such as pneumonia, bronchitis, tuberculosis, and leprosy. It also shows potent inhibitory activity against chronic inflammatory diseases including thp-1 cells and asthma. The mechanism of action for pipernonaline is through cation channel opening leading to an influx of calcium ions into the cell.</p>

<p>GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV</p>

<p>TENOVIN-5 is a peptide inhibitor of the P2X7 receptor. It is a high purity, stable, and water insoluble compound that can be used as a research tool to study protein interactions, ligand binding and activation of the P2X7 receptor. TENOVIN-5 has been shown to bind to the extracellular domain of the P2X7 receptor and inhibit its function. TENOVIN-5 also activates the P2Y1 receptor in a dose-dependent manner.</p>

<p>Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF</p>

<p>LYZL6 antibody was raised in Rabbit using Human LYZL6 as the immunogen</p>

<p>Purified recombinant CKS1B protein (His tag)</p>

<p>CCL16 antibody was raised in rabbit using the N terminal of CCL16 as the immunogen</p>

<p>SNAI1 antibody was raised in rabbit using the N terminal of SNAI1 as the immunogen</p>

<p>Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP</p>

<p>MEIS3 antibody was raised in rabbit using the middle region of MEIS3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MKRN2 antibody, catalog no. 70R-2130</p>

<p>AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF</p>

<p>Rabbit polyclonal PSG4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL37 antibody, catalog no. 70R-2424</p>

<p>Na, K ATPase antibody was raised in mouse using purified rat kidney Na, K ATPase as the immunogen.</p>

<p>BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK</p>

<p>Region of FGF5 protein corresponding to amino acids MAWAHGEKRL APKGQPGPAA TDRNPIGSSS RQSSSSAMSS SSASSSPAAS LGSQGSGLEQ SSFQWSPSGR RTGSLYCRVG IGFHLQIYPD GKVNGSHEAN MLSVLEIFAV SQGIVGIRGV FSNKFLAMSK KGKLHASAKF TDDCKFRERF QENSYNTYAS AIHRTEKTGR EWYVALNKRG KAKRGCSPRV KPQHISTHFL PRFKQSEQPE LSFTVTVPEK KNPPSPIKSK IPLSAPRKNT NSVKYRLKFR FG.</p>

<p>MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL</p>

<p>Goat anti-monkey IgG was raised in goat using monkey IgG chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLCC1 antibody, catalog no. 70R-1789</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LARP1 antibody, catalog no. 70R-4916</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>BDH1 antibody was raised in Mouse using a purified recombinant fragment of human BDH1 expressed in E. coli as the immunogen.</p>

<p>GTPBP3 antibody was raised in Rabbit using Human GTPBP3 as the immunogen</p>

<p>Goat IgG protein is a versatile immunoglobulin that has various applications in the field of Life Sciences. It can be used as a primary or secondary antibody for immunohistochemistry, Western blotting, ELISA, and other immunoassays. Goat IgG protein is highly specific and exhibits strong binding affinity to a wide range of target antigens.</p>

<p>Rabbit polyclonal Mt13 antibody</p>

<p>FIS1 antibody was raised in Rabbit using Human FIS1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF165 antibody, catalog no. 70R-2743</p>

<p>Canine Factor VIII antigen Matched Pair antibody Set for ELISA</p>

<p>Goat anti-human IgG (H+L) (HRP) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>The CYP2S1 antibody is a highly specialized insulin antibody that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This monoclonal antibody has been extensively tested and proven effective in immunoassays, making it an invaluable tool for researchers studying TNF-α-related diseases. Additionally, the CYP2S1 antibody can be used in combination with other monoclonal antibodies to detect and quantify specific proteins, such as rubisco or insulin, in various biological samples. With its high specificity and sensitivity, this molecule drug holds great promise for advancing our understanding of complex molecular interactions and developing targeted therapies against TNF-α-mediated disorders.</p>