Anticorpos primários

Affinity purified Rabbit polyclonal Slap antibody

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

Affinity purified Rabbit polyclonal PDZK3 antibody

Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.

Purified Polyclonal ATP8 antibody

Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK

CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.

CASP3 antibody was raised in Rabbit using Human CASP3 as the immunogen

The PAK1 antibody is a highly specific antibody used in the field of Life Sciences. It is capable of recognizing and binding to the amino-terminal and carboxyl terminal regions of PAK1, a protein involved in various cellular processes. This antibody can be utilized for a wide range of applications, including immunoassays, Western blotting, immunohistochemistry, and more.

The ADRA2A antibody is a powerful tool used in Life Sciences research. It specifically targets the ADRA2A protein, which plays a crucial role in various physiological processes such as influenza hemagglutinin binding and glucose-6-phosphate metabolism. This antibody has been extensively studied and validated for its specificity and sensitivity.

Affinity purified Rabbit polyclonal STRA8 antibody

Rabbit polyclonal BLOC1 antibody (FITC)

The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.

The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.

Sheep polyclonal Chlormadinone acetate antibody

Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.

CDC27 antibody was raised in Rabbit using Human CDC27 as the immunogen

IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

The IL10 antibody is a powerful cytotoxic agent used in Life Sciences research. It is an antibody that specifically targets and binds to interleukin-10 (IL-10), a cytokine involved in immune regulation. This antibody can be conjugated with cytotoxic agents to create a cytotoxic conjugate, which can selectively kill cells expressing IL-10 receptors.

The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.