Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.722 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.591 produtos)
- Anticorpos metabólicos(291 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.771 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75602 produtos de "Anticorpos primários"
Goat anti Rabbit IgG (H + L) (Alk Phos)
Goat anti-rabbit IgG (H + L) (Alk Phos) was raised in goat using rabbit IgG whole molecule as the immunogen.Pureza:Min. 95%CD11c antibody (FITC)
CD11c antibody (FITC) was raised in Mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.
Pureza:Min. 95%MRPL48 antibody
MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK
Antithrombin III antibody
Antithrombin III antibody was raised in goat using human antithrombin purified from plasma as the immunogen.Pureza:Min. 95%DIDO1 antibody
DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen
Pureza:Min. 95%GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Pureza:Min. 95%HIF3A antibody
HIF3A antibody was raised in rabbit using the C terminal of HIF3A as the immunogen
Pureza:Min. 95%HNE antibody
HNE antibody was raised in goat using 4-Hydroxynonenal protein as the immunogen.Pureza:Min. 95%CD8a antibody (biotin)
CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Pureza:Min. 95%OR13C9 antibody
OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen
Pureza:Min. 95%Fibronectin 1 antibody
Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIPureza:Min. 95%Goat anti Human IgM (mu chain) (HRP)
This antibody reacts with heavy chains on human IgM (mu chain).Pureza:Min. 95%DKK1 antibody
DKK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Pureza:Min. 95%p73 antibody
The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.
Pureza:Min. 95%
