Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
QSOX1 antibody
The QSOX1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can neutralize the activity of QSOX1, an enzyme involved in the formation of disulfide bonds in proteins. This antibody recognizes a conformational epitope on QSOX1 and inhibits its function as a topoisomerase inhibitor.
RLBP1L1 antibody
RLBP1L1 antibody was raised using the middle region of RLBP1L1 corresponding to a region with amino acids MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT
Caspase 6 antibody
The Caspase 6 antibody is a highly specialized immunoassay tool designed for neutralizing the activity of Caspase 6, a drug antibody that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathway mediated by Caspase 6. Additionally, it has shown promising results as a potential therapeutic agent for diseases involving abnormal cell proliferation.
RNF39 antibody
RNF39 antibody was raised using the N terminal of RNF39 corresponding to a region with amino acids EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
ZDHHC17 antibody
ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
VIM antibody
The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.
