Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
Goat anti Human kappa chain (rhodamine)
This antibody reacts with kappa light chains on human immunoglobulins.
Pureza:Min. 95%Donkey anti Goat IgG
Donkey anti-goat IgG was raised in donkey using goat IgG (H & L) as the immunogen.Pureza:Min. 95%Human Growth Hormone antibody (HRP)
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.
ASL antibody
The ASL antibody is a monoclonal antibody that is specifically designed to target and bind to the antigen ASL. This antibody is produced by hybridoma cells, which are created by fusing myeloma cells with B cells that have been immunized with the ASL antigen. The resulting hybridoma cell strain produces large quantities of this specific antibody.
GNB2 antibody
GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR
EWSR1 antibody
EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
Pirimiphos antibody
Pirimiphos antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies and is commonly used for research purposes. This antibody specifically targets insulin, a hormone that plays a crucial role in regulating blood sugar levels. By binding to insulin, Pirimiphos antibody can be used to study insulin signaling pathways and its involvement in various physiological processes.
CLDN4 antibody
The CLDN4 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of CLDN4, a protein that is activated in certain diseases. This antibody has shown promising results in inhibiting the growth of tumors expressing high levels of alpha-fetoprotein, a known marker for liver cancer. Additionally, the CLDN4 antibody has been found to block the chemokine signaling pathway, which plays a crucial role in cell migration and inflammation. It also acts as a serine protease inhibitor, preventing the activation of enzymes involved in tumor progression. With its high specificity and efficacy, this antibody holds great potential for therapeutic applications in the field of Life Sciences.
