Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
KIAA0692 antibody
KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
Troponin T Type 2 antibody
Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE
PNPLA3 antibody
PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
PBLD antibody
The PBLD antibody is a highly specific monoclonal antibody that targets the chemokine receptor PBLD. It plays a crucial role in the regulation of various immune responses, including the activation and migration of immune cells. The PBLD antibody has been extensively studied for its potential therapeutic applications in cancer immunotherapy and autoimmune diseases.
CD23 antibody
CD23 antibody is a monoclonal antibody that specifically targets the CD23 protein, a molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study the function and regulation of CD23. It can be used to detect and quantify CD23 expression levels in cells or tissues, providing valuable insights into its role in different physiological and pathological conditions. Additionally, CD23 antibody has been shown to inhibit the activity of derivatives such as ferritin and fibrinogen, suggesting its potential therapeutic applications in oxidative damage and inflammatory disorders. Furthermore, this antibody has been found to modulate hepatocyte growth factor and collagen synthesis, indicating its involvement in tissue repair and regeneration processes. With its high specificity and versatility, CD23 antibody is an indispensable tool for researchers studying various aspects of cellular signaling pathways and molecular interactions involving CD23.
IDH1 antibody
IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
SMP30 antibody
The SMP30 antibody is a polyclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been extensively studied and validated for its use in various applications, including transcription-polymerase chain reaction (PCR) analysis, immunohistochemistry staining, and Western blotting. It shows high specificity and sensitivity in detecting AFP in different samples, such as human serum and tissue sections.
CD154 antibody
The CD154 antibody is a monoclonal antibody that has various biological effects on the immune system. It interacts with CD40, a cell surface receptor, and plays a crucial role in immune responses. The CD154 antibody can stimulate the production of colony-stimulating factors and growth factors, which promote the growth and differentiation of leukocytes. It also enhances the expression of major histocompatibility complex class II molecules, facilitating antigen presentation to T cells. In addition, the CD154 antibody has been shown to inhibit low-density lipoprotein uptake by human serum macrophages. This antibody is widely used in life sciences research, including immunoassays and studies on thrombotic microangiopathy. Its binding to CD40 on human endothelial cells can trigger cellular activation and influence glycoprotein expression. With its diverse functions and applications, the CD154 antibody is an essential tool for understanding immune responses and developing therapeutic strategies in various fields of research.
