Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
Fatty Acid Synthase antibody
The Fatty Acid Synthase antibody is a highly specialized protein used in Life Sciences research. It is an essential tool for studying the role of fatty acid synthesis in various biological processes. This antibody specifically targets and neutralizes proteins involved in the synthesis of fatty acids, such as TNF-α, interleukin-6, and chemokines.
SNAP23 antibody
The SNAP23 antibody is a monoclonal antibody that specifically targets the protein SNAP23. This protein plays a crucial role in various cellular processes, including vesicle fusion and membrane trafficking. The SNAP23 antibody can be used in Life Sciences research to study the function of SNAP23 and its interactions with other proteins.
MKRN1 antibody
MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE
MCM3 antibody
The MCM3 antibody is a monoclonal antibody that specifically targets the growth factor MCM3. It acts as a neutralizing agent, inhibiting the activity of MCM3 and preventing its activation. This antibody has been widely used in Life Sciences research, particularly in studies involving trastuzumab, an anti-HER2 antibody. By blocking the interaction between MCM3 and epidermal growth factor receptors, this antibody effectively disrupts signaling pathways involved in cell growth and proliferation.
CD203c antibody
CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.
ICAM1 antibody
ICAM1 antibody was raised in Mouse using a purified recombinant fragment of human ICAM1(28-480aa) expressed in E. coli as the immunogen.METTL2B antibody
METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS
S100A8 antibody
The S100A8 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect and measure the levels of S100A8 protein in human serum samples. The antibody is immobilized on an electrode and reacts specifically with S100A8, allowing for accurate quantification. In addition to its use in diagnostics, the S100A8 antibody can also be used as a research tool. It can be used to study the role of S100A8 in various biological processes, such as inflammation and immune response. The antibody has neutralizing properties and can inhibit the activity of reactive oxygen species and interleukins. It is also being investigated as a potential therapeutic agent for conditions such as diuretic resistance and influenza hemagglutinin inhibition. With its versatility and specificity, the S100A8 antibody is a valuable tool for researchers in the life sciences field.
GSTT1 antibody
The GSTT1 antibody is a highly specific monoclonal antibody that targets the glutathione S-transferase theta 1 (GSTT1) protein. This antibody is commonly used in Life Sciences research to study the role of GSTT1 in various biological processes.
