Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75448 produtos de "Anticorpos primários"
GCLM antibody
GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
IL4 antibody
IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.
HSF2 antibody
The HSF2 antibody is a biomolecule widely used in Life Sciences research. It plays a crucial role in various applications such as electrophoresis, neutralizing specific proteins or molecules, and measuring microvessel density. This antibody has shown promising results in inhibiting the activity of erythropoietin, a growth factor involved in red blood cell production. Additionally, it has been used as an immunosuppressant and is commonly employed in immunoassays to detect specific targets. The HSF2 antibody exhibits cytotoxic properties and can be utilized as a tool for targeted therapy. It is available as a monoclonal antibody and can be combined with other colloidal inhibitors for enhanced efficacy. Researchers also explore the potential of this antibody as a natriuretic agent due to its ability to regulate fluid balance within the body.
CD25 antibody (biotin)
CD25 antibody (biotin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.
Pureza:Min. 95%Goat anti Rat IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.
Pureza:Min. 95%Haptoglobin antibody
Haptoglobin antibody is a monoclonal antibody that specifically targets haptoglobin, a human protein found in plasma. It is widely used in Life Sciences research to study the role of haptoglobin in various biological processes. Haptoglobin antibody has been shown to bind to haptoglobin expressed in human hepatocytes and inhibit its function. This antibody can also be used for immunohistochemistry and Western blotting to detect haptoglobin levels in human serum samples. Additionally, haptoglobin antibody has been used in studies investigating the interaction between haptoglobin and other molecules such as fatty acids, lectins, and transport proteins. Its specificity and high affinity make it a valuable tool for researchers studying the functions of haptoglobin and its polymorphic variants.
FPR1 antibody
The FPR1 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to e-cadherin, a glycoprotein involved in cell adhesion. This colloidal antibody has been extensively studied for its inhibitory effects on e-cadherin expression and its potential as a therapeutic agent in various diseases.
Caspase 7 antibody
The Caspase 7 antibody is a highly specialized nuclear receptor that plays a crucial role in apoptosis, the process of programmed cell death. This antibody specifically targets and binds to the HER2 protein, making it an effective anti-HER2 antibody. It belongs to the group of polyclonal antibodies, which are derived from multiple B-cell clones and can recognize different epitopes on the target protein.
CD68 antibody
The CD68 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD68, a glycoprotein that is expressed on the surface of activated macrophages, adipose tissue cells, and certain types of collagen. This antibody is widely used in research and diagnostic applications to detect the presence of CD68 in various biological samples, such as human serum or tissues.
Cystatin C antibody
Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.
