Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75447 produtos de "Anticorpos primários"
ZDHHC17 antibody
ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
HAVCR1 antibody
HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRPureza:Min. 95%VIM antibody
The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.
Goat anti Rabbit IgG (Fab'2) (HRP)
Goat anti-rabbit IgG (Fab'2) (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Pureza:Min. 95%Plasminogen antibody (HRP)
Plasminogen antibody (HRP) was raised in goat using human plasminogen purified from plasma as the immunogen.DKK3 antibody
The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.
Epsin 2 antibody
Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM
HIPK2 antibody
The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.
ATP6V1B2 antibody
ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK
USP22 antibody
USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE
Strongzyme Goat anti Rabbit IgG (H + L) (HRP)
Strongzyme Goat anti Rabbit IgG (H + L) secondary antibody (HRP)
Pureza:Min. 95%
