Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75447 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
MUC1 antibody
MUC1 antibody was raised using the N terminal of MUC1 corresponding to a region with amino acids SATQRSSVPSSTEKNALSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELPureza:Min. 95%KLRA1 antibody
KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLPureza:Min. 95%TPX2 antibody
TPX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK
Pureza:Min. 95%SRPRB antibody
SRPRB antibody was raised using the middle region of SRPRB corresponding to a region with amino acids QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Pureza:Min. 95%CDC2 antibody
CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCFPureza:Min. 95%GJD3 antibody
GJD3 antibody was raised in rabbit using the C terminal of GJD3 as the immunogen
Pureza:Min. 95%UCRC antibody
UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Pureza:Min. 95%CHSY2 antibody
CHSY2 antibody was raised using the N terminal Of Chsy-2 corresponding to a region with amino acids PPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGGAAGQRRDGRPGSSHNGPureza:Min. 95%Hspb7 antibody
Hspb7 antibody was raised in rabbit using the middle region of Hspb7 as the immunogenPureza:Min. 95%C14orf129 antibody
C14orf129 antibody was raised in rabbit using the middle region of C14orf129 as the immunogenPureza:Min. 95%TFPI2 antibody
TFPI2 antibody was raised in rabbit using the N terminal of TFPI2 as the immunogenPureza:Min. 95%GRIM19 antibody
GRIM19 antibody was raised in rabbit using residues 159-172 QAETDRRTLQMLRE of the human GRIM-19 protein as the immunogen.Pureza:Min. 95%TFAP2C antibody
TFAP2C antibody was raised in rabbit using the middle region of TFAP2C as the immunogenPureza:Min. 95%GRIP1 antibody
GRIP1 antibody was raised in rabbit using the C terminal of GRIP1 as the immunogenPureza:Min. 95%ROM1 antibody
ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTPureza:Min. 95%TNRC18 antibody
TNRC18 antibody was raised in rabbit using the N terminal of TNRC18 as the immunogenPureza:Min. 95%TMTC4 antibody
TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWPureza:Min. 95%ZP1 antibody
ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGLPureza:Min. 95%Zc3h3 antibody
Zc3h3 antibody was raised in rabbit using the N terminal of Zc3h3 as the immunogenPureza:Min. 95%
