Anticorpos primários

MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF

GOLM1 antibody was raised using the N terminal of GOLM1 corresponding to a region with amino acids RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS

The DCC antibody is a monoclonal antibody used in Life Sciences research. It specifically targets interferon and brain natriuretic peptide, making it a valuable tool for studying these molecules. The DCC antibody has been extensively tested and validated using spectrometric techniques to ensure its accuracy and reliability. It can be used in various applications such as Western blotting, immunohistochemistry, and ELISA assays. This monoclonal antibody is produced using state-of-the-art technology and is free from any contaminants or impurities. It comes with detailed instructions for use and storage recommendations. Streptavidin conjugated versions of the DCC antibody are also available for biotinylation or hybridization experiments. Whether you need a monoclonal or polyclonal antibody, the DCC antibody is an excellent choice that provides specific and reliable results.

GTF3C5 antibody was raised in rabbit using the N terminal of GTF3C5 as the immunogen

GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW

hCG_1982709 antibody was raised in rabbit using the N terminal of HCG_1982709 as the immunogen

The Histone H4 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the nuclear chromatin, allowing for the detection and analysis of histone H4 protein. This antibody has been widely used in various applications, including immunocytochemical localization and immunohistochemical detection.

Purified Polyclonal ARMCX2 antibody

Tcf7l2 antibody was raised in rabbit using the N terminal of Tcf7l2 as the immunogen

LOC729185 antibody was raised using the N terminal Of Loc729185 corresponding to a region with amino acids VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG

GCLC antibody was raised in rabbit using the middle region of GCLC as the immunogen

KLK12 antibody was raised in rabbit using residues 236-248 [KYVDWIRMIMRNN] of the human KLK12 protein as the immunogen.

ATP2B3 antibody was raised using the N terminal of ATP2B3 corresponding to a region with amino acids AEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQ

MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA

The HDAC8 antibody is a monoclonal antibody that belongs to the class of inhibitors. It is used in Life Sciences for various applications, including research and diagnostics. This antibody specifically targets HDAC8, which is a member of the histone deacetylase family. HDAC8 plays a crucial role in regulating gene expression by removing acetyl groups from histones, thereby affecting chromatin structure and transcriptional activity. The HDAC8 antibody can be used to study the function of HDAC8 in different biological processes, such as cell proliferation, differentiation, and apoptosis. It has also been used in combination with other antibodies or drugs to explore potential therapeutic strategies for various diseases, including cancer and neurodegenerative disorders. With its high specificity and affinity, the HDAC8 antibody offers researchers a valuable tool for understanding the molecular mechanisms underlying these conditions and developing targeted therapies.

ATP2A3 antibody was raised using the middle region of ATP2A3 corresponding to a region with amino acids LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS