Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.621 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75447 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
FGG antibody
FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQPureza:Min. 95%FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSPureza:Min. 95%LEC antibody
LEC antibody was raised in goat using highly pure recombinant human LEC as the immunogen.Pureza:Min. 95%MDM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.Pureza:Min. 95%WNT5B antibody
WNT5B antibody was raised using the middle region of WNT5B corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCPureza:Min. 95%STK38 antibody
STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDPureza:Min. 95%HEPACAM antibody
HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTPureza:Min. 95%TBK1 antibody
TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM
Pureza:Min. 95%LONRF2 antibody
LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHRPureza:Min. 95%Gal3st4 antibody
Gal3st4 antibody was raised in rabbit using the C terminal of Gal3st4 as the immunogenPureza:Min. 95%IFN Alpha 7 antibody
IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
Pureza:Min. 95%Gm527 antibody
Gm527 antibody was raised in rabbit using the C terminal of Gm527 as the immunogenPureza:Min. 95%PLUNC antibody
PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLPureza:Min. 95%Septin 11 antibody
Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETPureza:Min. 95%CRMP1 antibody
CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS
Pureza:Min. 95%Cytokeratin AE1 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin AE1 antibody (Prediluted for IHC)Pureza:Min. 95%ABCG5 antibody
ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
Pureza:Min. 95%SLC14A1 antibody
SLC14A1 antibody was raised using the C terminal of SLC14A1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGMPureza:Min. 95%Smarcd3 antibody
Smarcd3 antibody was raised in rabbit using the C terminal of Smarcd3 as the immunogenPureza:Min. 95%UBL4A antibody
UBL4A antibody was raised in rabbit using the middle region of UBL4A as the immunogenPureza:Min. 95%
