Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.709 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(738 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75327 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
GPSN2 antibody
GPSN2 antibody was raised using the C terminal of GPSN2 corresponding to a region with amino acids LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPVPureza:Min. 95%CDKN3 antibody
CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGPureza:Min. 95%Zfp161 antibody
Zfp161 antibody was raised in rabbit using the middle region of Zfp161 as the immunogenPureza:Min. 95%NPTX2 antibody
<p>NPTX2 antibody was raised in rabbit using the N terminal of NPTX2 as the immunogen</p>Pureza:Min. 95%TMEM9 antibody
<p>TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS</p>Pureza:Min. 95%CD100 antibody
CD100 antibody was raised in rabbit using residues 777-788 [KPKSDFCDREQS] of the human CD100 protein as the immunogen.Pureza:Min. 95%MCM8 antibody
<p>MCM8 antibody was raised using the C terminal of MCM8 corresponding to a region with amino acids IRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQH</p>Pureza:Min. 95%SMPD1 antibody
<p>SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV</p>Pureza:Min. 95%MS4A4A antibody
MS4A4A antibody was raised using the N terminal of MS4A4A corresponding to a region with amino acids MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHLPureza:Min. 95%ZNF334 antibody
ZNF334 antibody was raised in rabbit using the N terminal of ZNF334 as the immunogenPureza:Min. 95%ZDHHC24 antibody
ZDHHC24 antibody was raised using the middle region of ZDHHC24 corresponding to a region with amino acids QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAPureza:Min. 95%ZBTB3 antibody
ZBTB3 antibody was raised in rabbit using the middle region of ZBTB3 as the immunogenPureza:Min. 95%SERPINB10 antibody
SERPINB10 antibody was raised in rabbit using residues 316-330 [SQSKADFSGMSSARN] of the human SERPINB10 protein as the immunogen.Pureza:Min. 95%SEPN1 antibody
SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogenPureza:Min. 95%Hey1 antibody
Hey1 antibody was raised in rabbit using the C terminal of Hey1 as the immunogenPureza:Min. 95%PHF23 antibody
PHF23 antibody was raised in rabbit using the N terminal of PHF23 as the immunogenPureza:Min. 95%Epsilon Tubulin 1 antibody
<p>Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG</p>Pureza:Min. 95%MRS2L antibody
MRS2L antibody was raised using the middle region of Mrs2L corresponding to a region with amino acids LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELPureza:Min. 95%TMEM161B antibody
TMEM161B antibody was raised using the N terminal of TMEM161B corresponding to a region with amino acids ESKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDFTVAATVVYLVPureza:Min. 95%ZNF619 antibody
ZNF619 antibody was raised in rabbit using the N terminal of ZNF619 as the immunogenPureza:Min. 95%
