Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75447 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
SLCO2B1 antibody
SLCO2B1 antibody was raised using the N terminal of SLCO2B1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
Pureza:Min. 95%YPEL5 antibody
YPEL5 antibody was raised in rabbit using the N terminal of YPEL5 as the immunogenPureza:Min. 95%CFP antibody
CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSPureza:Min. 95%MFSD1 antibody
MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMPureza:Min. 95%CRLF1 antibody
CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLPureza:Min. 95%Ccna2 antibody
Ccna2 antibody was raised in rabbit using the C terminal of Ccna2 as the immunogenPureza:Min. 95%Bmp2 antibody
Bmp2 antibody was raised in rabbit using the middle region of Bmp2 as the immunogenPureza:Min. 95%KIAA1754L antibody
KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKTPureza:Min. 95%HRG antibody
HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGPureza:Min. 95%ZNF415 antibody
ZNF415 antibody was raised in rabbit using the N terminal of ZNF415 as the immunogen
Pureza:Min. 95%MCM7 antibody
MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIPureza:Min. 95%AADAC antibody
AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNPureza:Min. 95%FGF17 antibody
FGF17 antibody was raised in rabbit using highly pure recombinant human FGF-17 as the immunogen.Pureza:Min. 95%IL1 alpha antibody
IL1 alpha antibody was raised using the N terminal of IL1A corresponding to a region with amino acids VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSPureza:Min. 95%SLC25A34 antibody
SLC25A34 antibody was raised using the middle region of SLC25A34 corresponding to a region with amino acids TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQHPureza:Min. 95%Rab10 antibody
Rab10 antibody was raised in rabbit using the C terminal of Rab10 as the immunogenPureza:Min. 95%PEX10 antibody
PEX10 antibody was raised using the C terminal of PEX10 corresponding to a region with amino acids ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYRPureza:Min. 95%E2f7 antibody
E2f7 antibody was raised in rabbit using the N terminal of E2F7 as the immunogenPureza:Min. 95%HOMEZ antibody
HOMEZ antibody was raised in rabbit using the N terminal of HOMEZ as the immunogen
Pureza:Min. 95%Decorin antibody
Decorin antibody was raised using the C terminal of DCN corresponding to a region with amino acids FCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYKPureza:Min. 95%
