Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75447 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
LOC652119 antibody
LOC652119 antibody was raised in rabbit using the C terminal of LOC652119 as the immunogenPureza:Min. 95%Slc9a7 antibody
Slc9a7 antibody was raised in rabbit using the C terminal of Slc9a7 as the immunogenPureza:Min. 95%C1ORF25 antibody
C1ORF25 antibody was raised in rabbit using the N terminal of C1ORF25 as the immunogenPureza:Min. 95%PAXIP1 antibody
PAXIP1 antibody was raised in rabbit using the N terminal of PAXIP1 as the immunogenPureza:Min. 95%KLHL31 antibody
KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
Pureza:Min. 95%GSR antibody
GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPPureza:Min. 95%COMMD8 antibody
COMMD8 antibody was raised in rabbit using the middle region of COMMD8 as the immunogenPureza:Min. 95%TMED1 antibody
TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFPureza:Min. 95%TRIM58 antibody
TRIM58 antibody was raised in rabbit using the middle region of TRIM58 as the immunogenPureza:Min. 95%ZNF567 antibody
ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogenPureza:Min. 95%DIRAS1 antibody
DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD
Pureza:Min. 95%Ela1 antibody
Ela1 antibody was raised in rabbit using the middle region of Ela1 as the immunogenPureza:Min. 95%PTGES3 antibody
PTGES3 antibody was raised in rabbit using the middle region of PTGES3 as the immunogenPureza:Min. 95%CYP1A1 antibody
CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVPureza:Min. 95%ETHE1 antibody
ETHE1 antibody was raised in rabbit using the middle region of ETHE1 as the immunogenPureza:Min. 95%LOC641765 antibody
LOC641765 antibody was raised in rabbit using the C terminal of LOC641765 as the immunogenPureza:Min. 95%LST-3TM12 antibody
LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLEPureza:Min. 95%ZBTB6 antibody
ZBTB6 antibody was raised in rabbit using the N terminal of ZBTB6 as the immunogen
Pureza:Min. 95%
