Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75448 produtos de "Anticorpos primários"
LYRM1 antibody
LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP
PBLD antibody
The PBLD antibody is a highly specific monoclonal antibody that targets the chemokine receptor PBLD. It plays a crucial role in the regulation of various immune responses, including the activation and migration of immune cells. The PBLD antibody has been extensively studied for its potential therapeutic applications in cancer immunotherapy and autoimmune diseases.
ROR1 antibody
ROR1 antibody was raised in Mouse using recombinant extracellular fragment of human ROR1 (aa30-406) fused with hIgGFc tag, expressed in HEK293 cells as the immunogen.MCM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Donkey anti Goat IgG (H + L) (biotin)
Donkey anti-goat IgG (H+L) (biotin) was raised in donkey using goat IgG whole molecule as the immunogen.Pureza:Min. 95%Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.
SLC1A5 antibody
SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
KLRG1 antibody (PE)
KLRG1 antibody (PE) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.
Pureza:Min. 95%CD23 antibody
CD23 antibody is a monoclonal antibody that specifically targets the CD23 protein, a molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study the function and regulation of CD23. It can be used to detect and quantify CD23 expression levels in cells or tissues, providing valuable insights into its role in different physiological and pathological conditions. Additionally, CD23 antibody has been shown to inhibit the activity of derivatives such as ferritin and fibrinogen, suggesting its potential therapeutic applications in oxidative damage and inflammatory disorders. Furthermore, this antibody has been found to modulate hepatocyte growth factor and collagen synthesis, indicating its involvement in tissue repair and regeneration processes. With its high specificity and versatility, CD23 antibody is an indispensable tool for researchers studying various aspects of cellular signaling pathways and molecular interactions involving CD23.
Lipase antibody (Pancreatic)
Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
