Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75447 produtos de "Anticorpos primários"
CLIC6 antibody
CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV
RuBisCO antibody
The RuBisCO antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and interacts with RuBisCO, an enzyme involved in the carbon fixation process during photosynthesis. This antibody has been extensively studied and proven to be effective in various research applications.
CD8 antibody (Spectral Red)
CD8 antibody (Spectral Red) was raised in mouse using human CD8 as the immunogen.
IDO antibody
The IDO antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme indoleamine 2,3-dioxygenase (IDO). This enzyme plays a crucial role in the regulation of immune responses and is involved in various physiological processes. The IDO antibody has been extensively used to study the function and activity of IDO in different cell types and tissues.
GRM1 antibody
The GRM1 antibody is a monoclonal antibody that has been developed for the treatment of thrombotic microangiopathy and atypical hemolytic disorders. It specifically targets the glucose transporter nuclear protein, which plays a crucial role in the development and progression of these conditions. The GRM1 antibody has shown promising results in preclinical studies, effectively reducing thrombotic events and improving overall patient outcomes. This drug antibody can be administered as an intravenous infusion, with the effective dose determined based on individual patient characteristics. In addition to its therapeutic potential, the GRM1 antibody is also widely used in life sciences research for various applications, including immunohistochemistry and flow cytometry analysis. Whether you are a researcher or a healthcare professional, the GRM1 antibody offers a valuable tool for studying and treating thrombotic microangiopathy and atypical hemolytic disorders.
FAM161A antibody
FAM161A antibody was raised in rabbit using the C terminal of FAM161A as the immunogen
HAVCR1 antibody
The HAVCR1 antibody is a polyclonal antibody that targets the protein known as HAVCR1. This antibody plays a crucial role in various biological processes, including caspase-9 activation, nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathway, β-catenin stabilization, and p38 mitogen-activated protein kinase (MAPK) activation.
