Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75448 produtos de "Anticorpos primários"
Methcathinone antibody
The Methcathinone antibody is a highly effective neutralizing agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target autoantibodies. This antibody has shown remarkable efficacy in inhibiting the activity of acidic molecules such as β-catenin and TGF-beta1 (also known as TGF-β1). Additionally, it has been proven effective in blocking the action of trastuzumab, fibronectin, collagen, and alpha-fetoprotein. The Methcathinone antibody is widely recognized for its exceptional binding affinity and specificity towards TGF-beta, making it an invaluable tool in protein research and therapeutic applications.
Pureza:Min. 95%Goat anti Cat IgG (FITC)
Goat anti-cat IgG (FITC) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.
Pureza:Min. 95%LGI4 antibody
LGI4 antibody was raised in Rat using Mouse Lgi4 peptide coupled to carrier protein as the immunogen.IL8 antibody
The IL8 antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets IL8, which is an important chemokine involved in inflammation and immune responses. The IL8 antibody can be used for various applications, including immunohistochemistry, flow cytometry, and ELISA. It has been extensively validated and shows high sensitivity and specificity in detecting IL8 in various samples. The IL8 antibody is produced using advanced techniques to ensure high purity and activity. It is supplied as a buffered solution for easy handling and storage. Whether you are studying autoimmune diseases or investigating the role of IL8 in cancer development, the IL8 antibody is a valuable tool for your research needs.
HTR2C antibody
HTR2C antibody was raised in rabbit using the N terminal of HTR2C as the immunogenPureza:Min. 95%ACTR1A antibody
ACTR1A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
SERINC2 antibody
SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
Pureza:Min. 95%MAOA antibody
The MAOA antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of the MAOA enzyme. This enzyme plays a crucial role in various physiological processes, including the regulation of lipoprotein lipase, interleukin-6, and adipose tissue metabolism. By inhibiting MAOA activity, this antibody has been shown to have significant effects on cellular processes such as fas-mediated apoptosis, phosphatase activity, actin filament organization, and erythropoietin signaling.
