Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75512 produtos de "Anticorpos primários"
PCYT2 antibody
PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
Goat anti Human kappa chain (rhodamine)
This antibody reacts with kappa light chains on human immunoglobulins.
Pureza:Min. 95%AIMP2 antibody
AIMP2 antibody was raised in rabbit using the middle region of AIMP2 as the immunogen
Pureza:Min. 95%alpha Tubulin antibody
The alpha Tubulin antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target and bind to alpha tubulin, a protein that plays a crucial role in cell division and intracellular transport. This antibody has been extensively tested and validated for its genotoxic activity, making it an essential tool for researchers studying various cellular processes.
SEMA3D antibody
SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Pureza:Min. 95%HS3ST5 antibody
HS3ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH
Pureza:Min. 95%Mouse Thymocyte antibody
Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.Pureza:Min. 95%IRX6 antibody
IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen
Pureza:Min. 95%NSUN3 antibody
NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP
PDE8B antibody
PDE8B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Pureza:Min. 95%Lactoferrin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.Mouse RBC antibody (FITC)
Mouse RBC antibody (FITC) was raised in rabbit using mouse erythrocytes as the immunogen.
