Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
Hepatitis B Virus antibody
Hepatitis B virus antibody was raised in mouse using hepatitis B virus as the immunogen.IL13 antibody
The IL13 antibody is a monoclonal antibody that specifically targets IL-13, a cytokine involved in various immune responses and inflammatory processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in fluorescence-activated cell sorting (FACS) experiments. It has a molecular weight suitable for complex formation and can effectively inhibit the activity of IL-13.
FGF23 antibody
FGF23 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets FGF23, a glycosylated protein involved in mineralization regulation. The FGF23 antibody has been developed to neutralize the activity of FGF23, making it an essential tool for researchers studying bone and mineral metabolism. This antibody is produced using advanced techniques, including colloidal gold labeling or microsphere conjugation, ensuring high specificity and sensitivity. Whether used in immunoassays or as a research tool, the FGF23 antibody provides valuable insights into the role of FGF23 and its signaling pathways, including protein kinase and 3-kinase activation.
Carbonic Anhydrase I antibody
The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.
TGFBI antibody
TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Salmonella antibody
Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.PCT monoclonal antibody
The PCT monoclonal antibody is a cutting-edge product in the field of Life Sciences. It is specifically designed to target and bind to hepatocyte growth factor, making it a valuable tool for research and diagnostic purposes. This monoclonal antibody is produced by hybridoma cells, ensuring high specificity and purity. The PCT monoclonal antibody has been extensively tested and validated for its effectiveness in various applications, including immunohistochemistry, Western blotting, and ELISA assays. Its unique glycosylation pattern ensures optimal performance and stability. This versatile antibody can be used to study the activation of creatine kinase, antibodies against collagen, apical membrane proteins, human folate receptors, and phosphatase activity. With its exceptional quality and reliability, the PCT monoclonal antibody is an essential tool for researchers in the field of Life Sciences.SEPP1 antibody
SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
ApoH antibody
ApoH antibody was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.
