Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75512 produtos de "Anticorpos primários"
ACTR1A antibody
ACTR1A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
VAMP5 antibody
VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
MIP1 beta antibody (biotin)
MIP1 beta antibody (biotin) was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.
Helicobacter pylori antibody
Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.CD11c antibody (FITC)
CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.
Pureza:Min. 95%Cytokeratin 75 antibody
Cytokeratin 75 antibody was raised using the N terminal of KRT75 corresponding to a region with amino acids MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI
ID3 antibody
The ID3 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It specifically targets and neutralizes the glial fibrillary acidic protein (GFAP), which is an important marker for activated astrocytes in the central nervous system. This antibody plays a crucial role in various life sciences research, particularly in studying the functions and interactions of astrocytes in different physiological and pathological conditions. Additionally, the ID3 antibody has been extensively used in adipose tissue research to investigate the role of astrocytes in regulating fatty acid metabolism and adipogenesis. Its high specificity and affinity make it an invaluable tool for scientists working in these fields.CUX2 antibody
CUX2 antibody was raised in rabbit using the N terminal of CUX2 as the immunogen
Pureza:Min. 95%CD8 antibody
The CD8 antibody is a monoclonal antibody that belongs to the family of kinase inhibitors. It is widely used in Life Sciences for its cytotoxic properties. The CD8 antibody targets specific protein complexes and inhibits their function, leading to cell death through apoptosis. This monoclonal antibody has been shown to be effective against various diseases and conditions, including hepatic lipase activity, dopamine regulation, vasoactive intestinal peptide signaling, and necrosis factor-related apoptosis-inducing pathways. With its potent inhibitory effects, the CD8 antibody offers promising therapeutic potential in the field of molecular biology and immunology.
CD11a antibody (Azide Free)
CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.
Pureza:Min. 95%UCP2 antibody
UCP2 antibody was raised in rabbit using a 14 amino acid peptide from mouse UCP2 as the immunogen.Pureza:Min. 95%CD8a antibody (Spectral Red)
CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.
Pureza:Min. 95%
