Anticorpos primários

Mouse monoclonal PDE4B antibody

CALR3 antibody was raised in Rabbit using Human CALR3 as the immunogen

The Caspase 6 antibody is a highly specialized affinity ligand that belongs to the class of polyclonal antibodies. It is specifically designed for the isolation and detection of retinal caspase 6, an important enzyme involved in programmed cell death. This antibody is commonly used in life sciences research, particularly in studies related to apoptosis and cell death pathways. It can be used as a powerful tool for investigating caspase 6 inhibitors, nuclear intermediates, and potential therapeutic medicines. The Caspase 6 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable choice for researchers working with caspase 6-related studies. Whether you are conducting experiments or developing diagnostic tests, this antibody will provide accurate and reproducible results. With its high-quality formulation and solubilized format, it offers ease of use and convenience in various applications. Trust the Caspase 6 antibody to enhance your research capabilities and advance your scientific discoveries.

Rabbit polyclonal PFKFB2 antibody

CD1 antibody (biotin) was raised in mouse using porcine CD1 as the immunogen.

Affinity purified Rabbit polyclonal SENP2 antibody

Rabbit polyclonal PHIP antibody

The C1S antibody is a monoclonal antibody that targets the cholinergic growth factor. It is designed to specifically bind to and neutralize the activity of C1S, a protease involved in various biological processes. This antibody has been shown to induce cell lysis and inhibit the activity of C1S in human serum. Additionally, it has anti-idiotypic properties, meaning it can bind to and block the binding of other antibodies to their target molecules. The C1S antibody is widely used in life sciences research for its ability to study protease activity and glycopeptide metabolism. Its low pH stability makes it suitable for various applications requiring acidic conditions. With its high specificity and neutralizing capabilities, this monoclonal antibody is an invaluable tool for studying C1S-related processes in both basic research and therapeutic development.

The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.

CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

Rabbit polyclonal TRIM54 antibody

CHRNA4 antibody was raised in rabbit using the N terminal of CHRNA4 as the immunogen

Affinity purified Rabbit polyclonal NSFL1C antibody

Affinity purified Rabbit polyclonal ZNF143 antibody

CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.

FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN

The MAP2 antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in neutralizing the effects of glutamate, a growth factor involved in various cellular processes. This monoclonal antibody specifically targets endothelial growth and has been shown to inhibit the proliferation and migration of endothelial cells. Additionally, it has been found to bind to alpha-synuclein, a protein associated with neurodegenerative diseases like Parkinson's. The MAP2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific needs. Its application extends beyond basic research, as it can be used in studies involving mesenchymal stem cells and microvessel density analysis. With its high specificity and sensitivity, the MAP2 antibody is an invaluable tool for scientists aiming to understand complex biological processes at the molecular level.