Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
ANP32B antibody
ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE
Troponin I antibody
The Troponin I antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize Troponin I, a glycoprotein involved in muscle contraction. This antibody has been extensively studied and proven to have high affinity and specificity for Troponin I.Neuropsin antibody
The Neuropsin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activated form of Neuropsin, an enzyme involved in various physiological processes. This antibody has been shown to inhibit the activity of Neuropsin, which plays a crucial role in fatty acid metabolism and the regulation of inflammatory responses.
MPP5 antibody
MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
SH1 antibody
The SH1 antibody is a polyclonal antibody that has been developed as a potential biological tool for studying tumor biomarkers. It specifically targets the IL-17A antigen, which is known to be involved in various protein-protein interactions and signaling pathways. The SH1 antibody can be used in various life science applications, including immunohistochemistry, western blotting, and ELISA assays. It has been shown to exhibit strong inhibition effects on IL-17A activity in vitro and in vivo. The SH1 antibody is produced using a eukaryotic expression vector and synthetic techniques, ensuring high purity and specificity. With its unique characteristics and versatility, the SH1 antibody is an essential tool for researchers investigating IL-17A-related pathways and exploring potential therapeutic interventions.
LYPD6 antibody
LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSPureza:Min. 95%KLRC1 antibody
The KLRC1 antibody is a polyclonal antibody that specifically targets the chemokine-activated receptor KLRC1. This antibody is commonly used in life sciences research and has been shown to have high affinity and specificity for KLRC1. It can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA. The KLRC1 antibody has been proven effective in detecting KLRC1 expression in human serum samples and has been used to study its role in various biological processes. This antibody has also been utilized in the development of therapeutic inhibitors targeting KLRC1 signaling pathways. With its reliable performance and versatility, the KLRC1 antibody is an essential tool for researchers studying protein kinases and their associated pathways.
KRT8 antibody
The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.
CD45RO antibody
The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.
