Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.722 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.591 produtos)
- Anticorpos metabólicos(291 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.771 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75602 produtos de "Anticorpos primários"
HDAC8 antibody
The HDAC8 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to histone deacetylase 8 (HDAC8), a nuclear enzyme involved in gene regulation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
BTBD10 antibody
BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL
FOXP1 antibody
The FOXP1 antibody is a highly effective and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP1 protein, which plays a crucial role in various cellular processes. This antibody binds to the nuclear-activated FOXP1 protein, allowing for its detection and analysis.
C1R antibody
C1R antibody is a polyclonal antibody that targets the C1R protein complex. It has neutralizing properties and can be used in various life science applications. This antibody has been shown to inhibit the activity of interferon, TNF-α, and interleukin-6. It can be used in research studies to investigate the role of C1R in different biological processes. The C1R antibody is highly specific and reliable, making it an essential tool for researchers working with biomolecules. Whether you are studying dopamine signaling or exploring the effects of haloperidol and droperidol, this antibody will provide accurate and reproducible results.
alpha 1 Antiplasmin antibody
alpha 1 Antiplasmin antibody was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.
STAT1 antibody
The STAT1 antibody is a glycopeptide that specifically targets and binds to the STAT1 protein. It is used in various research applications, including the detection and quantification of autoantibodies. The STAT1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.
Pseudorabies Virus antibody
Pseudorabies Virus antibody is a vital tool in the field of Life Sciences. It is a polyclonal antibody that can be used for various applications. This antibody specifically targets the Pseudorabies Virus, which is a highly contagious viral disease that affects animals, especially pigs. The Pseudorabies Virus antibody can be used in research studies to detect and quantify the presence of the virus in samples.
