Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.722 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.591 produtos)
- Anticorpos metabólicos(291 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.771 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75602 produtos de "Anticorpos primários"
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody that targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) protein. This cysteine-rich protein plays a crucial role in various cellular processes, including glycolysis and energy metabolism. Additionally, GAPDH has been identified as an angiogenic inducer and an activated growth factor.
C11ORF65 antibody
C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
CD22 antibody
The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.
HSF1 antibody
The HSF1 antibody is a medicament that consists of dimers with an amino-terminal domain. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α) and natriuretic peptides. This glycoprotein antibody is widely used in Life Sciences research for its ability to detect and quantify specific proteins in various biological samples. The HSF1 antibody can be used in applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The HSF1 antibody's high specificity and sensitivity make it an essential tool for studying cellular processes and protein functions. With its advanced glycosylation techniques, this antibody ensures accurate results by minimizing non-specific binding and interference from other molecules.
TNFSF10 antibody
TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
Donkey anti Goat IgG (H + L) (biotin)
Donkey anti-goat IgG (H+L) (biotin) was raised in donkey using goat IgG whole molecule as the immunogen.Pureza:Min. 95%Goat anti Human IgG (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain).Pureza:Min. 95%
