Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.722 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.591 produtos)
- Anticorpos metabólicos(291 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.771 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75602 produtos de "Anticorpos primários"
Haptoglobin antibody
Haptoglobin antibody is a monoclonal antibody that specifically targets haptoglobin, a human protein found in plasma. It is widely used in Life Sciences research to study the role of haptoglobin in various biological processes. Haptoglobin antibody has been shown to bind to haptoglobin expressed in human hepatocytes and inhibit its function. This antibody can also be used for immunohistochemistry and Western blotting to detect haptoglobin levels in human serum samples. Additionally, haptoglobin antibody has been used in studies investigating the interaction between haptoglobin and other molecules such as fatty acids, lectins, and transport proteins. Its specificity and high affinity make it a valuable tool for researchers studying the functions of haptoglobin and its polymorphic variants.
FPR1 antibody
The FPR1 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to e-cadherin, a glycoprotein involved in cell adhesion. This colloidal antibody has been extensively studied for its inhibitory effects on e-cadherin expression and its potential as a therapeutic agent in various diseases.
BTBD12 antibody
BTBD12 antibody was raised in rabbit using the N terminal of BTBD12 as the immunogen
Pureza:Min. 95%CDK7 antibody
CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen
Pureza:Min. 95%SGCG antibody
SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS
Tau antibody
The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.
