Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.722 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.591 produtos)
- Anticorpos metabólicos(291 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.771 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75602 produtos de "Anticorpos primários"
MMP2 antibody
The MMP2 antibody is a highly specialized polyclonal antibody that targets the matrix metalloproteinase 2 (MMP2) protein. This antibody is widely used in life sciences research to study the role of MMP2 in various biological processes. MMP2 is a key enzyme involved in the degradation of extracellular matrix components, and its dysregulation has been implicated in several diseases, including cancer, cardiovascular diseases, and inflammatory disorders.
Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.
Goat anti Human IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Pureza:Min. 95%CDH1 antibody
CDH1 antibody was raised in Mouse using a purified recombinant fragment of human CDH1 expressed in E. coli as the immunogen.CEA antibody
The CEA antibody is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells. This antibody specifically binds to CEA and can be used for various applications in the field of Life Sciences. It has been widely used in research studies to detect CEA expression in tumor tissues and monitor its levels in patient samples.
CUGBP2 antibody
CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP
SIGLEC9 antibody
The SIGLEC9 antibody is a polyclonal antibody that specifically targets SIGLEC9, a glycoprotein that plays a crucial role in various biological processes. This antibody is produced using glycine and disulfide bond technology, resulting in high-quality antibodies with excellent specificity and sensitivity. It can be used in various applications in the field of life sciences, such as immunohistochemistry, flow cytometry, and Western blotting.
