Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
VDAC1 antibody
The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.
TM9SF1 antibody
TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
AVEN antibody
The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.
MFAP3L antibody
MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
SCD antibody
SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
DKK1 antibody
DKK1 antibody was raised in Mouse using a purified recombinant fragment of DKK1 expressed in E. coli as the immunogen.TOP2A antibody
The TOP2A antibody is a polyclonal antibody that targets the TOP2A protein. This protein is involved in various cellular processes, including DNA replication and repair. It plays a crucial role in regulating cell growth and division.
RAD18 antibody
The RAD18 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine receptor RAD18, which is involved in the immune response. This antibody can be used for various applications, such as immunoassays and neutralizing experiments. The RAD18 antibody is a chimeric protein composed of human immunoglobulin and can effectively bind to RAD18 glycoprotein. It has been shown to activate interferon and steroid signaling pathways, making it a valuable tool for studying immune responses and related diseases. With its high specificity and potency, the RAD18 antibody is an essential component in any research involving chemokines and their interactions with the immune system.
