Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
Mycoplasma pneumoniae antibody
Mycoplasma pneumoniae antibody is a product used in Life Sciences research to study protein-protein interactions. It is a monoclonal antibody that specifically targets and binds to Mycoplasma pneumoniae, a bacterium known to cause respiratory infections. The antibody can be used in various applications such as immunohistochemical detection, fluorescence immunochromatography, and polymerase chain reactions. It is highly specific and sensitive, making it an ideal tool for detecting the presence of Mycoplasma pneumoniae in samples such as human serum or cell cultures. This antibody can also be used to study the role of Mycoplasma pneumoniae in autoimmune diseases by investigating the presence of autoantibodies. Its high affinity for Mycoplasma pneumoniae antigens ensures accurate and reliable results in research experiments.
PAD4 antibody
The PAD4 antibody is a highly specialized medicament used in the field of Life Sciences. It is an acidic, EGF-like glycoprotein that plays a crucial role in various biological processes. This antibody is particularly known for its ability to neutralize and inhibit the activity of glial fibrillary acidic protein (GFAP), which is found predominantly in adipocytes.
RAD23A antibody
RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
MAG antibody
The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.
CD2 antibody
The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.
CRP antibody
CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of human BRAF expressed in E. coli as the immunogen.
Factor VIII antibody
Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.
SPP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
