CymitQuimica logo
Anticorpos primários

Anticorpos primários

Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.

Subcategorias de "Anticorpos primários"

Exibir 1 mais subcategorias

Foram encontrados 75562 produtos de "Anticorpos primários"

Ordenar por

Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
produtos por página.
  • MAP2K1 antibody (Thr292)


    Rabbit polyclonal MAP2K1 antibody (Thr292)

    Ref: 3D-70R-15010

    100µl
    Descontinuado
    Produto descontinuado
  • Mycoplasma pneumoniae antibody


    Mycoplasma pneumoniae antibody is a product used in Life Sciences research to study protein-protein interactions. It is a monoclonal antibody that specifically targets and binds to Mycoplasma pneumoniae, a bacterium known to cause respiratory infections. The antibody can be used in various applications such as immunohistochemical detection, fluorescence immunochromatography, and polymerase chain reactions. It is highly specific and sensitive, making it an ideal tool for detecting the presence of Mycoplasma pneumoniae in samples such as human serum or cell cultures. This antibody can also be used to study the role of Mycoplasma pneumoniae in autoimmune diseases by investigating the presence of autoantibodies. Its high affinity for Mycoplasma pneumoniae antigens ensures accurate and reliable results in research experiments.

    Ref: 3D-10-2822

    500µg
    Descontinuado
    Produto descontinuado
  • CLDN18 antibody


    CLDN18 antibody was raised in Rabbit using Human CLDN18 as the immunogen

    Ref: 3D-70R-16445

    50µl
    Descontinuado
    Produto descontinuado
  • CAMK2 A/B antibody (Thr286)


    Rabbit polyclonal CAMK2 A/B antibody (Thr286)

    Ref: 3D-70R-14946

    100µl
    Descontinuado
    Produto descontinuado
  • PAD4 antibody


    The PAD4 antibody is a highly specialized medicament used in the field of Life Sciences. It is an acidic, EGF-like glycoprotein that plays a crucial role in various biological processes. This antibody is particularly known for its ability to neutralize and inhibit the activity of glial fibrillary acidic protein (GFAP), which is found predominantly in adipocytes.

    Ref: 3D-70R-13577

    100µl
    Descontinuado
    Produto descontinuado
  • FMO3 antibody


    Affinity purified Rabbit polyclonal FMO3 antibody

    Ref: 3D-70R-14301

    100µg
    Descontinuado
    Produto descontinuado
  • RAD23A antibody


    RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

    Ref: 3D-70R-1037

    100µl
    Descontinuado
    Produto descontinuado
  • MAG antibody


    The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.

    Ref: 3D-70R-14288

    100µg
    Descontinuado
    Produto descontinuado
  • CD2 antibody


    The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.

    Ref: 3D-70R-14280

    100µg
    Descontinuado
    Produto descontinuado
  • CRP antibody


    CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

    Ref: 3D-70R-4527

    100µl
    Descontinuado
    Produto descontinuado
  • HCCS antibody


    HCCS antibody was raised in rabbit using the C terminal of HCCS as the immunogen

    Ref: 3D-70R-10235

    100µl
    Descontinuado
    Produto descontinuado
  • GAMT antibody


    GAMT antibody was raised in Rabbit using Human GAMT as the immunogen

    Ref: 3D-70R-17419

    50µl
    Descontinuado
    Produto descontinuado
  • BRAF antibody


    BRAF antibody was raised in Mouse using a purified recombinant fragment of human BRAF expressed in E. coli as the immunogen.

    Ref: 3D-10R-2042

    100µl
    Descontinuado
    Produto descontinuado
  • XRCC2 antibody


    Affinity purified Rabbit polyclonal XRCC2 antibody

    Ref: 3D-70R-12489

    100µl
    Descontinuado
    Produto descontinuado
  • Factor VIII antibody


    Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.

    Ref: 3D-70R-31180

    100µg
    Descontinuado
    Produto descontinuado
  • ALPI antibody


    Rabbit polyclonal ALPI antibody

    Ref: 3D-70R-15272

    100µg
    Descontinuado
    Produto descontinuado
  • SPP1 antibody


    The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

    Ref: 3D-70R-13972

    100µg
    Descontinuado
    Produto descontinuado
  • AFP antibody (Fab'2)


    Goat polyclonal AFP antibody (Fab'2)

    Ref: 3D-70R-14344

    1mg
    Descontinuado
    Produto descontinuado
  • MYO1B antibody


    Affinity purified Rabbit polyclonal MYO1B antibody

    Ref: 3D-70R-13608

    100µl
    Descontinuado
    Produto descontinuado
  • HICE1 antibody


    Affinity purified Rabbit polyclonal HICE1 antibody

    Ref: 3D-70R-12549

    100µl
    Descontinuado
    Produto descontinuado