Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75562 produtos de "Anticorpos primários"
UGT2B7 antibody
The UGT2B7 antibody is a powerful tool in Life Sciences research. This antibody has the ability to neutralize fatty acids and EGF-like molecules, making it an essential component in various immunoassays and molecular docking experiments. It exhibits high affinity for human serum albumin and cationic molecules, allowing for precise targeting and detection of specific proteins or chemokines. The UGT2B7 antibody belongs to the class of polyclonal antibodies, ensuring a wide range of binding specificity. With its exceptional performance and versatility, this antibody is a valuable asset for researchers in the field of Life Sciences.
TACC3 antibody
The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.
RTN4 antibody
RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
Pureza:Min. 95%Tau antibody
The Tau antibody is a medicament that belongs to the class of globulin-based drugs. It is a polyclonal antibody that has been specifically designed to target and neutralize the activity of Tau protein. Tau protein plays a crucial role in the pathogenesis of neurodegenerative diseases, such as Alzheimer's disease, by forming abnormal aggregates in the brain.
Pureza:Min. 95%Helicobacter pylori antibody (HRP)
Helicobacter pylori antibody (HRP) was raised in rabbit using ATCC strain 43504 as the immunogen.Ferritin heavy chain antibody
The Ferritin heavy chain antibody is a highly effective monoclonal antibody used in Life Sciences. It is designed to specifically target and bind to the Ferritin heavy chain protein, which plays a crucial role in iron storage and transport within cells. This antibody is colloidal in nature, making it easy to use in various experimental techniques.
FYN antibody
The FYN antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the activated form of the FYN protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to effectively inhibit the activity of FYN, making it an invaluable tool for researchers studying signal transduction pathways and cellular signaling.
Procainamide antibody
Procainamide antibody was raised in mouse using procainamide conjugated to KLH as the immunogen.MST1R antibody
MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Pureza:Min. 95%IL18 antibody
IL18 antibody is a monoclonal antibody that acts as a medicament to target specific proteins in the body. It has cytotoxic properties, meaning it can destroy targeted cells or inhibit their growth. IL18 antibody specifically targets plasminogen activator receptor and alpha-fetoprotein, which are proteins involved in various biological processes. By binding to these proteins, IL18 antibody neutralizes their function and prevents them from carrying out their normal activities.
