Anticorpos primários

Rabbit polyclonal GRIN2C antibody (Ser1096)

WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen

The AKR1B1 antibody is a glycoprotein that targets a specific human protein. It is widely used in the field of Life Sciences for its antiviral properties. This antibody is commonly used in immunoassays, where it plays a crucial role in detecting and quantifying the presence of the target protein. The AKR1B1 antibody can also be used as a tool in various research applications, such as studying fatty acid metabolism or investigating the role of progesterone in cellular processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. The AKR1B1 antibody has been extensively tested and validated, ensuring reliable and accurate results in experiments. Whether you are conducting basic research or developing diagnostic assays, this antibody is an essential tool for your scientific endeavors.

Netrin 1 antibody is a growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets netrin 1, a protein involved in cell migration and axon guidance. This antibody can be used for various applications, including research in the life sciences field.

The PCNA antibody is a highly specific monoclonal antibody that targets the proliferating cell nuclear antigen (PCNA). It is commonly used in research and diagnostic applications to detect and quantify PCNA expression levels. PCNA plays a crucial role in DNA replication and repair, making it an important marker for cell proliferation and DNA synthesis. The PCNA antibody can be used to study various biological processes such as cell cycle progression, tumor growth, and response to DNA damage. With its high specificity and sensitivity, this antibody provides reliable results for researchers in the field of life sciences. Whether you are studying cellular pathways or investigating disease mechanisms, the PCNA antibody is an essential tool for your research.

CD79b antibody (PE) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.

The Beta tubulin antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to target and bind to beta tubulin, a protein involved in cell division and intracellular transport. This antibody plays a crucial role in various research applications, including the study of amyloid plaque formation, growth factor signaling pathways, antiangiogenic therapies, and the development of inhibitors such as taxol.

TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

Rabbit polyclonal SEC24A antibody

The Angiopoietin 2 antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody designed to neutralize the activity of Angiopoietin 2, a glycoprotein involved in angiogenesis and vascular remodeling. This antibody has been extensively tested and proven to be highly specific and effective in blocking the interaction between Angiopoietin 2 and its receptor, thereby inhibiting angiogenesis.

Mouse monoclonal GSTT2 antibody

Mouse monoclonal NPTN antibody

Mouse monoclonal BDH2 antibody

Calpain 10 antibody was raised using the N terminal of CAPN10 corresponding to a region with amino acids MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEIC

Affinity purified Rabbit polyclonal NEGR1 antibody

ICAM2 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to be involved in the regulation of immune responses, cell adhesion, and signal transduction. This antibody specifically targets ICAM2, an antigen expressed on the surface of cells.

Mouse monoclonal CD1d antibody (PE)