Anticorpos primários

Rabbit polyclonal BUD31 antibody

HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)

Affinity purified Rabbit polyclonal PDSS2 antibody

CPNE6 antibody was raised in Rabbit using Human CPNE6 as the immunogen

Affinity purified Rabbit polyclonal CAMK1D antibody

Murine anti-p26 HIV Monoclonal Antibody

Rabbit polyclonal EPHB2 antibody (Tyr298)

Rat monoclonal MHC Class II antibody (biotin)

The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.

LAT2 antibody was raised in Rabbit using Human LAT2 as the immunogen

ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

Rabbit polyclonal SFN antibody

Mouse monoclonal EPSP synthase antibody

Goat anti-rat IgM (FITC) was raised in goat using rat IgM mu chain as the immunogen.