Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75448 produtos de "Anticorpos primários"
Gabrp antibody
Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen
Pureza:Min. 95%MKK3 antibody
The MKK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to alpha-fetoprotein, a glycoprotein that plays a crucial role in various biological processes. This antibody can be used in a variety of assays, including immunohistochemistry and Western blotting, to detect and quantify the presence of alpha-fetoprotein in samples.
Pureza:Min. 95%GALNT2 antibody
The GALNT2 antibody is a monoclonal antibody that targets the GALNT2 protein. This antibody is commonly used in life sciences research, particularly in the study of growth factors and tyrosine kinase receptors. It can be used in immunoassays to detect and quantify GALNT2 levels in various biological samples.
PIB5PA antibody
PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Pureza:Min. 95%BRM antibody
The BRM antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It is an inhibitor that targets specific virus surface antigens, preventing their interaction with host cells and inhibiting viral replication. This antibody has shown high efficacy against a wide range of viruses, including those causing respiratory infections, influenza, and herpes.
SEPP1 antibody
SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
Luteinizing Hormone antibody
Luteinizing hormone antibody was raised in mouse using human pituitary luteinizing hormone as the immunogen.DPP9 antibody
DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Pureza:Min. 95%FAM53C antibody
FAM53C antibody was raised using the N terminal of FAM53C corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG
Fibrinogen antibody
Fibrinogen antibody was raised in mouse using fibrin degradation products as the immunogen.BTBD12 antibody
BTBD12 antibody was raised in rabbit using the N terminal of BTBD12 as the immunogen
Pureza:Min. 95%
