Anticorpos primários

Affinity purified Rabbit polyclonal C1orf57 antibody

Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.

Affinity purified Rabbit polyclonal MID1IP1 antibody

Sheep polyclonal DNM1 antibody (Ser774)

EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE

GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR

The CCR10 antibody is a monoclonal antibody that specifically targets CCR10, a chemokine receptor involved in immune responses. This antibody can be used for various applications in the field of Life Sciences, including research and diagnostics. It has been shown to effectively neutralize the activity of CCR10 by binding to its natural ligand and preventing its interaction with other molecules. The CCR10 antibody can be used in hybridization experiments to detect the presence of CCR10 mRNA or protein in different tissues or cell types. Additionally, it can be used in immunohistochemistry or flow cytometry assays to study the expression pattern of CCR10 in various biological samples. This antibody is highly specific and exhibits low cross-reactivity with other related receptors. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The CCR10 antibody is a valuable tool for studying immune responses, inflammation, and adipose tissue biology.

DBNL antibody was raised in Rabbit using Human DBNL as the immunogen

The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.

Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.

The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to dopamine beta hydroxylase, an enzyme involved in the synthesis of norepinephrine. This antibody is commonly used in research and diagnostic assays to study the role of dopamine beta hydroxylase in various biological processes.

The BAK1 antibody is a test compound used in Life Sciences research. It is a protein reagent that is commonly used in the field of Antibodies. This antibody specifically targets hematopoietic cells and can be used to study their function in various biological processes. The BAK1 antibody has high affinity for its target and can be used as an inhibitor to block specific interactions or signaling pathways. Additionally, it has been shown to have therapeutic potential in the field of pluripotent stem cell research, where it can be used to manipulate DNA double-strand breaks and promote cellular differentiation. With its versatility and wide range of applications, the BAK1 antibody is an essential tool for researchers in the Life Sciences field.

The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.

GADD45GIP1 antibody was raised in Rabbit using Human GADD45GIP1 as the immunogen

The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.

TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen

Affinity purified Rabbit polyclonal DYNC1I2 antibody