Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75447 produtos de "Anticorpos primários"
Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using purified human lactoferrin as the immunogen.Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.
Pureza:Min. 95%ETFA antibody
ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Pureza:Min. 95%AQP1 antibody
The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.
S6K1 antibody
The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this
Pureza:Min. 95%CD49d antibody (PE)
CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.
Pureza:Min. 95%Snx10 antibody
Snx10 antibody was raised in rabbit using the middle region of Snx10 as the immunogenPureza:Min. 95%PPP1R3A antibody
PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEPureza:Min. 95%AFP antibody
AFP antibody was raised in mouse using purified human alpha-fetoprotein as the immunogen.
Sheep anti Rabbit IgG (H + L) (Alk Phos)
Sheep anti-rabbit IgG (H+L) (Alk Phos) was raised in sheep using rabbit IgG whole molecule as the immunogen.Pureza:Min. 95%COPS6 antibody
COPS6 antibody was raised in rabbit using the middle region of COPS6 as the immunogenPureza:Min. 95%CD11b antibody (PE)
CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.
Pureza:Min. 95%Rab23 antibody
Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen
Pureza:Min. 95%Transferrin Receptor antibody
The Transferrin Receptor antibody is a monoclonal antibody that specifically targets the transferrin receptor, which is involved in the uptake of iron into cells. This antibody has been extensively studied in various fields of life sciences and has shown promising results. It has been used in adipose tissue research to study the role of transferrin in growth factor signaling pathways. In low-molecular-weight toxicity studies, this antibody has been found to be safe and well-tolerated.ZNF567 antibody
ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogenPureza:Min. 95%
