Anticorpos primários

GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE

CDC25A antibody was raised in rabbit using the middle region of CDC25A as the immunogen

Purified Rabbit polyclonal PKA antibody (Thr197)

The Tyrosine Hydroxylase antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and detect tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter essential for brain function. This antibody is commonly used in immunoassays to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.

Rabbit polyclonal SLC9A8 antibody

The CYP1A2 antibody is a growth factor that plays a crucial role in various biological processes. It acts as an electrode, facilitating the transfer of electrons to proteins and fatty acids. This activated molecule drug also exhibits anticoagulant properties and has been shown to possess anti-VEGF (vascular endothelial growth factor) activity. Additionally, it interacts with insulin, albumin, and fibrinogen, making it a versatile therapeutic agent. The CYP1A2 antibody is a monoclonal antibody that targets endogenous hematopoietic cells and is commonly used in research and clinical settings. Its efficacy has been demonstrated in human serum, highlighting its potential for diagnostic applications.

Mouse monoclonal TUBAL3 antibody

SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen

The EGFR antibody is a highly specialized monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is designed to inhibit the growth and spread of cancer cells by blocking the interaction between EGFR and its ligands. This antibody has been extensively studied for its potential in treating various types of cancer, including lung, breast, colorectal, and head and neck cancers.

entB Monoclonal Antibody Biotin

GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Mouse Lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.

C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

Rabbit polyclonal RPS6KA2 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. The effectiveness of this drug has been demonstrated through transcription-quantitative polymerase chain reactions, as well as patch-clamp techniques on human erythrocytes. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

Rabbit polyclonal RPP40 antibody

Sheep anti-Rabbit Albumin Polyclonal