Anticorpos primários

Mouse monoclonal KIAA0495 antibody

Rabbit polyclonal Actin gamma 2 antibody

Rabbit polyclonal MORF4L1 antibody

Please enquire for more information about anti-Mouse C3 Antibody (FITC) including the price, delivery time and more detailed product information at the technical inquiry form on this page

CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL

PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.

PDE7A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.

Rabbit polyclonal NFkB antibody (Regulatory Factor)

The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.

WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS

FGFR4 antibody was raised in Rabbit using Human FGFR4 as the immunogen

Rabbit polyclonal RRAGB antibody

Rabbit polyclonal TRMT5 antibody

NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP

Rabbit polyclonal SURF1 antibody

Rabbit polyclonal RBBP6 antibody

HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen

Mouse monoclonal EPSP synthase antibody