Anticorpos primários

RPS6KB1 antibody was raised using the N terminal of RPS6KB1 corresponding to a region with amino acids KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF

Rabbit polyclonal TAS2R7 antibody

The HSP antibody is a monoclonal antibody that has pharmacokinetic properties. It is formulated using crystalline cellulose and human serum, making it highly effective in targeting specific biomolecules. This antibody has been shown to be particularly effective in treating choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. The HSP antibody works by neutralizing oxidative damage and preventing toxic effects on the retina. Additionally, this monoclonal antibody has shown promising results in combination with sorafenib, an inhibitor of epidermal growth factor receptors. With its potent therapeutic properties, the HSP antibody is a valuable tool in the field of life sciences and holds great potential for future medical advancements.

Histone H4 antibody is a polyunsaturated antibody that specifically targets the histone H4 protein. This antibody has been shown to neutralize the activity of arachidonic acid, a key molecule involved in various biological processes. By blocking the action of arachidonic acid, this antibody can inhibit the angiogenic response and reduce inflammation. It has also been used in Life Sciences research to study the effects of chemical inhibitors on erythropoietin and other angiogenesis-related proteins. Additionally, this monoclonal antibody has been utilized to investigate the role of histone H4 in arachidonic acid metabolism and its impact on cellular processes. With its high specificity and ability to target activated histone H4 residues, this antibody is an essential tool for studying the intricate mechanisms of arachidonic acid signaling pathways and their involvement in various physiological and pathological conditions.

HAND2 antibody was raised in mouse using recombinant Human Heart And Neural Crest Derivatives Expressed 2 (Hand2)

Purified Rabbit polyclonal NFKBID antibody

Mouse lymphocyte antibody was raised in rabbit using RBC-free leporidae thymus and spleen cells as the immunogen.

The STAT6 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the STAT6 protein, which is involved in various cellular processes. This antibody has been shown to be effective in neutralizing the activity of activated STAT6, preventing its interaction with other proteins and inhibiting downstream signaling pathways. Additionally, the STAT6 antibody has been found to inhibit the binding of fibrinogen and chemokines, thereby reducing inflammation. It also shows potential as an anti-mesothelin antibody, targeting a protein often overexpressed in certain cancers. Furthermore, this antibody has demonstrated antiviral activity by blocking viral entry into cells. Its ability to neutralize growth factors makes it a valuable tool for studying cell proliferation and differentiation processes. In summary, the STAT6 antibody is a versatile research tool with diverse applications in various fields of study within the Life Sciences domain.

CD94 antibody (FITC) was raised in rat using CHO cells transfected with the B6 allele of CD94 as the immunogen.

Rabbit polyclonal TAS2R5 antibody

Purified Rabbit polyclonal Lck antibody (Tyr192)

Rabbit polyclonal RCL antibody

The CD9 antibody is a monoclonal antibody that belongs to the class of antibodies known as polyclonal antibodies. It specifically targets CD9, a protein that is involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of fibroin and natriuretic factors. Additionally, it has been found to have anti-VEGF activity, which makes it a potential candidate for anti-angiogenic therapy. The CD9 antibody also plays a role in hormone regulation and has been shown to modulate endothelial growth. In liver microsomes, this antibody acts as an inhibitor of caspase-9, thus preventing apoptosis. Furthermore, it has been found to interact with fatty acids and β-catenin, suggesting its involvement in lipid metabolism and cell signaling pathways. Overall, the CD9 antibody is a versatile tool with diverse applications in research and pharmaceutical development.

CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK

The CBL antibody is a highly effective inhibitor that targets nuclear chemokine receptors. This monoclonal antibody has neutralizing properties, making it an ideal choice for blocking the activity of acetylcholine and other autoantibodies. Additionally, the CBL antibody has antiangiogenic effects, making it a valuable tool in the field of Life Sciences.

CENPE Monoclonal Antibody BSA/Azide Free

C6ORF182 antibody was raised using the middle region of C6Orf182 corresponding to a region with amino acids DIECELECLLKKMEIKGEQISKLKKHQDSVCKLQQKVQNSKMSEASGIQQ

Thrombin antibody was raised in sheep using Thrombin prepared from purified rabbit Prothrombin as the immunogen.

Rabbit polyclonal FOXO4 antibody (Ser262)

PKC epsilon antibody is a polyclonal antibody that specifically targets the MERTK protein. This antibody is commonly used in life sciences research to study the role of MERTK in various cellular processes. MERTK is a receptor tyrosine kinase involved in the regulation of cell growth, survival, and differentiation. It plays a crucial role in the immune response, particularly in the clearance of apoptotic cells and antiviral defense mechanisms mediated by interferon signaling. The PKC epsilon antibody has been shown to be highly reactive and exhibits strong binding affinity towards MERTK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry analysis. Researchers can rely on this high-quality antibody to accurately detect and quantify MERTK expression levels in different tissues or cell types. Its specificity and reliability make it an invaluable tool for studying the function and regulation of MERTK in various biological processes.