Anticorpos primários
Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.764 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(736 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Exibir 1 mais subcategorias
Foram encontrados 75326 produtos de "Anticorpos primários"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
DOLPP1 antibody
<p>DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI</p>Pureza:Min. 95%Ccdc90b antibody
<p>Ccdc90b antibody was raised in rabbit using the N terminal of Ccdc90b as the immunogen</p>Pureza:Min. 95%VPS29 antibody
<p>VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL</p>Pureza:Min. 95%BCAS2 antibody
<p>BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL</p>MEKK2 antibody
<p>The MEKK2 antibody is an immunomodulatory substance that targets a specific phosphorylation site on collagen. It is designed to recognize and bind to this site, leading to the modulation of immune responses. This antibody can be used in various applications, including research studies, vaccine development, and the production of therapeutic antibodies.</p>FANCA antibody
<p>The FANCA antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to target and bind to the FANCA protein, which is involved in various cellular processes such as insulin-like growth factor signaling and DNA repair. This antibody has been extensively studied and proven to be effective in research related to trastuzumab, alpha-synuclein, and other proteins.</p>CHI3L1 antibody
<p>CHI3L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL</p>Pureza:Min. 95%Histone H3 antibody
<p>The Histone H3 antibody is a powerful tool used in the field of Life Sciences. It is an antibody-drug that specifically targets and binds to histone H3, a protein involved in gene regulation and chromatin structure. This polyclonal antibody is highly specific and can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.</p>Pureza:Min. 95%TMEM93 antibody
<p>TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG</p>Pureza:Min. 95%SOX10 antibody
<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>ESR1 antibody
<p>ESR1 antibody was raised in rabbit using the C terminal of ESR1 as the immunogen</p>Pureza:Min. 95%
