Anticorpos primários

<p>PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD</p>

<p>Rabbit polyclonal PFDN4 antibody</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>Rabbit polyclonal RSU1 antibody</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>NADK antibody was raised in Rabbit using Human NADK as the immunogen</p>

<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>Rabbit polyclonal PIH1D1 antibody</p>

<p>MAOA antibody was raised in Rabbit using Human MAOA as the immunogen</p>

<p>Human Haptoglobin Reference Serum</p>