Anticorpos primários

<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>LZTFL1 antibody was raised in Rabbit using Human LZTFL1 as the immunogen</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>The RRM2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets the growth hormone receptor and has been shown to inhibit lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used in various applications such as immunohistochemistry and Western blotting. It is available both as polyclonal antibodies, which offer broad specificity, and monoclonal antibodies, which provide high specificity. The RRM2 antibody has also been studied as a potential therapeutic target for inhibiting tyrosine kinase activity and blocking endothelial growth factor signaling pathways. Additionally, it has been used in combination with other inhibitors, such as trastuzumab, to enhance their efficacy. With its versatility and potential applications, the RRM2 antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>Mouse monoclonal HAG2 antibody</p>

<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>

<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>

<p>The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>

<p>The PAK7 antibody is a highly specialized product in the field of Life Sciences. It is an anti-MERTK antibody that specifically targets and binds to the activated form of the MERTK protein. This antibody is designed to facilitate antigen-antibody reactions, making it an essential tool for various research applications.</p>

<p>LOC730950 antibody was raised in rabbit using the C terminal of LOC730950 as the immunogen</p>

<p>4EBP1 antibody was raised in Mouse using a purified recombinant fragment of 4EBP1 expressed in E. coli as the immunogen.</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>