Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(740 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75447 produtos de "Anticorpos primários"
SLC5A4 antibody
SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Pureza:Min. 95%AMPK alpha antibody
The AMPK alpha antibody is a high-quality polyclonal antibody that is used in life sciences research. It specifically targets AMP-activated protein kinase (AMPK) alpha subunit and can be used for various applications such as immunohistochemistry, western blotting, and immunoprecipitation.
IpaD antibody
The IpaD antibody is a glycoprotein that has denaturing properties. It is known for its neuroprotective and neutralizing effects. This high polymer glycan has been found to interact with hormone peptides and collagens. The IpaD antibody is produced through the use of monoclonal antibodies, which are created through recombinant techniques. Its glycosylation plays a crucial role in its functionality. It should be noted that this antibody may have teratogenic effects and caution should be exercised when using it. The IpaD antibody is commonly used in research and diagnostic applications due to its specificity and affinity for its target antigen.HA antibody
The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.
ELAVL4 antibody
ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
FITC antibody (biotin)
FITC antibody (biotin) was raised in goat using fluorescein conjugated to goat IgG as the immunogen.
PSMC5 antibody
PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen
Pureza:Min. 95%RGMB antibody
The RGMB antibody is a highly potent monoclonal antibody that exhibits cytotoxic effects. It has been extensively studied and has shown promising results in various fields of Life Sciences. This antibody specifically targets RGMB, a protein involved in endothelial growth and development. By neutralizing RGMB, this antibody inhibits the signaling pathways associated with angiogenesis, making it a valuable tool for researchers studying vascular biology and related diseases.
SOCS1 antibody
The SOCS1 antibody is a powerful tool used in the field of Life Sciences for various research purposes. It is a Polyclonal Antibody that specifically targets the Suppressor of Cytokine Signaling 1 (SOCS1) protein. This antibody has been extensively tested and validated for its high specificity and sensitivity.
CD54 antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This powerful drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, effectively stopping the spread of the infection. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
SAAL1 antibody
SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL
STAT3 antibody
The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
Pureza:Min. 95%
