CymitQuimica logo
Anticorpos primários

Anticorpos primários

Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.

Subcategorias de "Anticorpos primários"

Exibir 1 mais subcategorias

Foram encontrados 75447 produtos de "Anticorpos primários"

Ordenar por

Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
produtos por página.
  • ARAF antibody


    The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.

    Ref: 3D-70R-12576

    100µl
    Descontinuado
    Produto descontinuado
  • ALAS1 antibody


    Rabbit polyclonal ALAS1 antibody raised against the N terminal of ALAS1

    Ref: 3D-70-1098

    100µl
    Descontinuado
    Produto descontinuado
  • C1R antibody


    The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.

    Ref: 3D-70R-31233

    1mg
    Descontinuado
    Produto descontinuado
  • Donkey anti Rabbit IgG (H + L) (rhodamine)


    Donkey anti-rabbit IgG (H+L) (Rhodamine) was raised in donkey using rabbit IgG whole molecule as the immunogen.

    Pureza:Min. 95%

    Ref: 3D-43C-CB1131

    1mg
    Descontinuado
    Produto descontinuado
  • KCNQ2 antibody


    KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

    Ref: 3D-70R-1525

    100µl
    Descontinuado
    Produto descontinuado
  • Adenosine A2AR antibody


    Affinity purified Rabbit polyclonal Adenosine A2AR antibody

    Ref: 3D-70R-12481

    100µl
    Descontinuado
    Produto descontinuado
  • NAT2 antibody


    Affinity purified Rabbit polyclonal NAT2 antibody

    Ref: 3D-70R-13584

    100µl
    Descontinuado
    Produto descontinuado
  • C-peptide antibody


    The C-peptide antibody is a monoclonal antibody that is used for various applications in medical research and diagnostics. It is designed to specifically target and bind to the C-peptide, a peptide released during the processing of proinsulin into insulin. This antibody has been extensively characterized and validated for its high specificity and sensitivity.

    Ref: 3D-10-2247

    1mg
    Descontinuado
    Produto descontinuado
  • Listeria antibody


    The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.

    Ref: 3D-20-LR19

    1ml
    Descontinuado
    Produto descontinuado
  • MOR antibody (Ser375)


    Rabbit polyclonal MOR antibody (Ser375)

    Ref: 3D-70R-30596

    100µg
    Descontinuado
    Produto descontinuado
  • CHIT1 antibody


    CHIT1 antibody was raised in Mouse using a purified recombinant fragment of CHIT1(aa22-137) expressed in E. coli as the immunogen.

    Ref: 3D-10R-2159

    100µl
    Descontinuado
    Produto descontinuado
  • SDC3 antibody


    The SDC3 antibody is a highly specialized antibody that targets the nuclear receptor SDC3. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the field of Life Sciences. This antibody specifically recognizes SDC3 and can be used to study its role in different biological processes.

    Ref: 3D-70R-20126

    50µl
    Descontinuado
    Produto descontinuado
  • Rabbit anti Chicken IgG (Alk Phos)


    Rabbit anti-chicken IgG (Alk Phos) was raised in rabbit using chicken IgG F(c) fragment as the immunogen.

    Pureza:Min. 95%

    Ref: 3D-43C-CB0321

    1mg
    Descontinuado
    Produto descontinuado
  • MMP1 antibody


    MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.

    Ref: 3D-10R-M112A

    100µg
    Descontinuado
    Produto descontinuado
  • NDF2 antibody


    Rabbit polyclonal NDF2 antibody

    Ref: 3D-70R-31921

    100µg
    Descontinuado
    Produto descontinuado
  • CTTN antibody


    CTTN antibody was raised in Rabbit using Human CTTN as the immunogen

    Ref: 3D-70R-16665

    50µl
    Descontinuado
    Produto descontinuado
  • WDR3 antibody


    WDR3 antibody was raised in rabbit using the middle region of WDR3 as the immunogen

    Ref: 3D-70R-10457

    100µl
    Descontinuado
    Produto descontinuado
  • ZC3H12A antibody


    The ZC3H12A antibody is a polyclonal antibody that is used in life sciences research. It has been shown to interact with various proteins and molecules, including alpha-fetoprotein, macrophage colony-stimulating factor, interferon, phosphatase, acidic glutamate, and vasoactive intestinal peptide. This antibody is commonly used in studies related to immune response and cell signaling pathways. It specifically targets the ZC3H12A protein, which is known to play a role in regulating inflammatory responses. The ZC3H12A antibody can be used for various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it a valuable tool for researchers studying immune system function and related diseases.

    Ref: 3D-70R-13391

    100µl
    Descontinuado
    Produto descontinuado
  • mGluR1 alpha antibody


    mGluR1 alpha antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human GluR1 alpha protein as the immunogen.
    Pureza:Min. 95%

    Ref: 3D-70R-GR011

    100µg
    Descontinuado
    Produto descontinuado
  • MELK antibody


    The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.

    Ref: 3D-70R-31887

    100µg
    Descontinuado
    Produto descontinuado