CymitQuimica logo
Anticorpos primários

Anticorpos primários

Os anticorpos primários são imunoglobulinas que se ligam especificamente a um antígeno de interesse, permitindo a detecção e quantificação de proteínas, peptídeos ou outras biomoléculas. Estes anticorpos são ferramentas essenciais em uma ampla gama de aplicações, incluindo Western blot, imunohistoquímica e ELISA. Na CymitQuimica, oferecemos uma vasta seleção de anticorpos primários de alta qualidade, proporcionando especificidade e sensibilidade para diversas necessidades de pesquisa, incluindo estudos sobre câncer, imunologia e biologia celular.

Subcategorias de "Anticorpos primários"

Exibir 1 mais subcategorias

Foram encontrados 75447 produtos de "Anticorpos primários"

Ordenar por

Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
produtos por página.
  • SLC5A4 antibody


    SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

    Pureza:Min. 95%

    Ref: 3D-20R-SR016

    50µg
    Descontinuado
    Produto descontinuado
  • PDCD8 antibody


    PDCD8 antibody was raised in rabbit using the N terminal of PDCD8 as the immunogen

    Ref: 3D-70R-10431

    100µl
    Descontinuado
    Produto descontinuado
  • SYMPK antibody


    Symplekin antibody was raised in mouse using human symplekin as the immunogen.

    Ref: 3D-10R-2452

    5ml
    Descontinuado
    Produto descontinuado
  • AMPK alpha antibody


    The AMPK alpha antibody is a high-quality polyclonal antibody that is used in life sciences research. It specifically targets AMP-activated protein kinase (AMPK) alpha subunit and can be used for various applications such as immunohistochemistry, western blotting, and immunoprecipitation.

    Ref: 3D-70R-30559

    100µg
    Descontinuado
    Produto descontinuado
  • IpaD antibody


    The IpaD antibody is a glycoprotein that has denaturing properties. It is known for its neuroprotective and neutralizing effects. This high polymer glycan has been found to interact with hormone peptides and collagens. The IpaD antibody is produced through the use of monoclonal antibodies, which are created through recombinant techniques. Its glycosylation plays a crucial role in its functionality. It should be noted that this antibody may have teratogenic effects and caution should be exercised when using it. The IpaD antibody is commonly used in research and diagnostic applications due to its specificity and affinity for its target antigen.

    Ref: 3D-10R-10513

    100µg
    Descontinuado
    Produto descontinuado
  • HA antibody


    The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.

    Ref: 3D-70R-10650

    1ml
    Descontinuado
    Produto descontinuado
  • Goat anti Monkey IgG (H + L) (HRP)


    Goat anti Monkey IgG (H + L) secondary antibody (HRP)

    Ref: 3D-43C-CB1603

    1mg
    Descontinuado
    Produto descontinuado
  • SOCS5 antibody


    Affinity purified Rabbit polyclonal SOCS5 antibody

    Ref: 3D-70R-12836

    100µl
    Descontinuado
    Produto descontinuado
  • TNFSF11 antibody (biotin)


    Rabbit polyclonal TNFSF11 antibody (biotin)

    Ref: 3D-60R-2001

    100µg
    Descontinuado
    Produto descontinuado
  • ELAVL4 antibody


    ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG

    Ref: 3D-70R-4836

    100µl
    Descontinuado
    Produto descontinuado
  • ORC6L antibody


    Rabbit polyclonal ORC6L antibody

    Ref: 3D-70R-19053

    50µl
    Descontinuado
    Produto descontinuado
  • FITC antibody (biotin)


    FITC antibody (biotin) was raised in goat using fluorescein conjugated to goat IgG as the immunogen.

    Ref: 3D-60R-FG003BT

    1mg
    Descontinuado
    Produto descontinuado
  • PSMC5 antibody


    PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen

    Pureza:Min. 95%

    Ref: 3D-20R-1193

    100µl
    Descontinuado
    Produto descontinuado
  • PDE2A antibody


    Mouse monoclonal PDE2A antibody

    Ref: 3D-10R-5179

    100µl
    Descontinuado
    Produto descontinuado
  • RGMB antibody


    The RGMB antibody is a highly potent monoclonal antibody that exhibits cytotoxic effects. It has been extensively studied and has shown promising results in various fields of Life Sciences. This antibody specifically targets RGMB, a protein involved in endothelial growth and development. By neutralizing RGMB, this antibody inhibits the signaling pathways associated with angiogenesis, making it a valuable tool for researchers studying vascular biology and related diseases.

    Ref: 3D-70R-13061

    100µl
    Descontinuado
    Produto descontinuado
  • SOCS1 antibody


    The SOCS1 antibody is a powerful tool used in the field of Life Sciences for various research purposes. It is a Polyclonal Antibody that specifically targets the Suppressor of Cytokine Signaling 1 (SOCS1) protein. This antibody has been extensively tested and validated for its high specificity and sensitivity.

    Ref: 3D-70R-13758

    100µg
    Descontinuado
    Produto descontinuado
  • ARAF antibody (Ser299)


    Rabbit polyclonal ARAF antibody (Ser299)

    Ref: 3D-70R-32633

    100µg
    Descontinuado
    Produto descontinuado
  • CD54 antibody


    6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This powerful drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, effectively stopping the spread of the infection. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

    Ref: 3D-70R-13774

    100µg
    Descontinuado
    Produto descontinuado
  • SAAL1 antibody


    SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL

    Ref: 3D-70R-4566

    100µl
    Descontinuado
    Produto descontinuado
  • STAT3 antibody


    The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.

    Pureza:Min. 95%

    Ref: 3D-20R-1911

    50µg
    Descontinuado
    Produto descontinuado