Anticorpos primários

GSTA2 antibody was raised in Rabbit using Human GSTA2 as the immunogen

HSPA13 antibody was raised in Rabbit using Human HSPA13 as the immunogen

The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.

The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.

The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the

The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.

The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.

The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.

ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen

The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.

Rabbit polyclonal NFKB p105/p50 antibody (Ser927)

Rabbit polyclonal GPR83 antibody

VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

The CYP2J2 antibody is a highly specialized monoclonal antibody that targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody specifically inhibits the activation of chemokine receptors, which are important for immune cell recruitment and inflammation. It has been extensively studied as a potential therapeutic target for various diseases, including cancer and cardiovascular disorders.

Collagen Type VI Alpha 2 antibody was raised using the C terminal of COL6A2 corresponding to a region with amino acids ARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAI

Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL

CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.

Rabbit polyclonal TRMT5 antibody