Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.620 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(751 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.551 produtos)
- Anticorpos metabólicos(279 produtos)
- Anticorpos de Microbiologia(739 produtos)
- Transdução de sinal(2.717 produtos)
- Etiquetas e Marcadores Celulares(33 produtos)
Foram encontrados 75447 produtos de "Anticorpos primários"
Androgen Receptor antibody
Androgen receptor antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) E V Q L G L G R V Y P R P P S K T Y R G(21) C of human androgen receptor as the immunogen.
Pureza:Min. 95%FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
WDR8 antibody
WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
Annexin A3 antibody
Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Fibrinogen antibody
Fibrinogen antibody was raised in mouse using fibrin degradation products as the immunogen.Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.PAK1 antibody
The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.
Pureza:Min. 95%PHF19 antibody
PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen
Pureza:Min. 95%HNRPLL antibody
HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
