Anticorpos primários

Rabbit polyclonal RNF168 antibody

MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

RLBP1L1 antibody was raised using the middle region of RLBP1L1 corresponding to a region with amino acids MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT

Rabbit polyclonal CKS1 antibody

Rabbit polyclonal Aquaporin PIP antibody

PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.

Mouse monoclonal SSR1 antibody

Rabbit polyclonal PLDN antibody

Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.

The PNMT antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of the neurotransmitter norepinephrine.

Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.

TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.

The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.

MYST2 antibody was raised in Rabbit using Human MYST2 as the immunogen

WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

Mouse monoclonal CD34 antibody (PE)

C4orf15 antibody was raised in Rabbit using Human C4orf15 as the immunogen

SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen