Anticorpos primários
Subcategorias de "Anticorpos primários"
- Investigação de anticorpos do cancro(3.721 produtos)
- Anticorpos Cardiovasculares(2 produtos)
- Biologia do Desenvolvimento(764 produtos)
- Anticorpos Epigenética(162 produtos)
- Anticorpos imunológicos(2.585 produtos)
- Anticorpos metabólicos(286 produtos)
- Anticorpos de Microbiologia(741 produtos)
- Transdução de sinal(2.765 produtos)
- Etiquetas e Marcadores Celulares(34 produtos)
Foram encontrados 75594 produtos de "Anticorpos primários"
Goat anti Mouse IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Pureza:Min. 95%TP53 antibody
The TP53 antibody is a glycoprotein that specifically targets the TP53 protein, also known as the tumor protein p53. This antibody is widely used in life sciences research to study the expression and function of TP53. It can be used in various applications such as Western blotting, immunohistochemistry, and immunoprecipitation. The TP53 antibody has been shown to have high specificity and sensitivity in detecting TP53 in nuclear extracts and human serum samples. This monoclonal antibody recognizes both wild-type and mutant forms of TP53, making it a valuable tool for studying the role of TP53 in cancer development and progression. With its superior performance and reliable results, the TP53 antibody is an essential reagent for researchers in the field of molecular biology and oncology.
LNX1 antibody
LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Pureza:(Sec-Hplc) Min. 95 Area-%Cor e Forma:Clear LiquidRef: 3D-BD165585
Produto descontinuadoHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
